Interaction between Poly [ADP-ribose] polymerase 1 (4dqy_A) and Poly [ADP-ribose] polymerase 1 (4dqy_C)
PDB and SCOP data
PDB ID: 4dqy (all binary interactions in this PDB entry)
Title: Structure of Human PARP-1 bound to a DNA double strand break
Release date: 2012-05-30
Resolution: 3.2 Å
-
Chain A: 4dqy_A
Title: Poly [ADP-ribose] polymerase 1
Source organism: Homo sapiens
Number of residues: 116 (30 missing in structure)
-
Chain B: 4dqy_C
Title: Poly [ADP-ribose] polymerase 1
Source organism: Homo sapiens
Number of residues: 506 (50 missing in structure)
Structural properties
Hetero-dimer interface properties
Buried interface area: 256.30 Å2
Number of inter-residue contacts at the interface: 20
Number of H-bonds: 5
Number of salt bridges: 1
Experimental structure
-
Pairwise interaction
-
Biological assembly
Heteromer, 3 proteins, 1 nucleic acid.
Interface structure modeling
Residues at the interaction interface
-
Interface residues in 4dqy_A
No. Residue no. in structure Residue no. in sequence Residue name Buried ASA, Å2 Buried ASA, % 1 40 60 Q 41.5 44.9 % 2 41 61 S 7.5 53.8 % 3 42 62 P 33.5 26.4 % 4 43 63 M 55.6 33.7 % 5 44 64 F 31.5 25.4 % 6 45 65 D 86.6 79.1 %
-
Interface residues in 4dqy_C
No. Residue no. in structure Residue no. in sequence Residue name Buried ASA, Å2 Buried ASA, % 1 566 50 T 17.5 52.9 % 2 567 51 N 6.7 70.6 % 3 568 52 S 18.5 60.2 % 4 589 73 W 29.9 31.2 % 5 590 74 G 11.1 82.1 % 6 591 75 R 34.4 75.7 % 7 595 79 V 4.5 2.9 % 8 596 80 I 58.7 75.1 % 9 597 81 G 29.6 63.7 % 10 598 82 S 26.8 44.1 % 11 746 230 M 18.7 15.6 %
Inter-residue contacts at the interaction interface
No. | Residue no. in chain A structure | Residue no. in chain A sequence | Residue in chain A | Residue no. in chain B structure | Residue no. in chain B sequence | Residue in chain B | Contact area, Å2 | Contact type |
---|---|---|---|---|---|---|---|---|
1 | 40 | 60 | Q | 591 | 75 | R | 4.0 | |
2 | 40 | 60 | Q | 596 | 80 | I | 18.8 | |
3 | 40 | 60 | Q | 746 | 230 | M | 18.7 | |
4 | 41 | 61 | S | 596 | 80 | I | 7.5 | |
5 | 42 | 62 | P | 595 | 79 | V | 4.5 | |
6 | 42 | 62 | P | 596 | 80 | I | 17.2 | |
7 | 42 | 62 | P | 597 | 81 | G | 11.9 | H-bond |
8 | 43 | 63 | M | 589 | 73 | W | 15.1 | H-bond |
9 | 43 | 63 | M | 597 | 81 | G | 13.7 | |
10 | 43 | 63 | M | 598 | 82 | S | 26.8 | |
11 | 44 | 64 | F | 589 | 73 | W | 14.8 | |
12 | 44 | 64 | F | 590 | 74 | G | 3.5 | |
13 | 44 | 64 | F | 596 | 80 | I | 9.3 | |
14 | 44 | 64 | F | 597 | 81 | G | 3.9 | |
15 | 45 | 65 | D | 566 | 50 | T | 17.5 | |
16 | 45 | 65 | D | 567 | 51 | N | 6.7 | H-bond |
17 | 45 | 65 | D | 568 | 52 | S | 18.5 | H-bond |
18 | 45 | 65 | D | 590 | 74 | G | 7.6 | |
19 | 45 | 65 | D | 591 | 75 | R | 30.4 | H-bond, Salt bridge |
20 | 45 | 65 | D | 596 | 80 | I | 5.9 |
Sequence alignments
-
Query protein: sp|P49916|DNLI3_HUMAN DNA ligase 3 OS=Homo sapiens GN=LIG3 PE=1 SV=2
Result domain: 4dqy_A; Poly [ADP-ribose] polymerase 1
Alignment data:
Expectation value = 3.15e-6, Score = 50 bits (118),
Identities = 31% (27/88), Positive = 53% (47/88), Gaps = 3% (3/88).
Interface alignment data:
Interface residues in alignment: 100% (6/6).
Identities = 17% (1/6), Positive = 50% (3/6), Gaps = 0% (0/6).
Query: 87 EMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRIGKVVPNPFSESGGDMKEWYHIKCMFEK 146
E +++ + V+YAK G A CKKC E I K R+ +V +P + G + WYH C ++
4dqy_A: 23 ESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFD--GKVPHWYHFSCFWKV 80
dssp: ---EEEEE------E------E-----EEEEEEEE----- -EEEEEEE--HHHH-
Query: 147 LERARATTKKIEDLTELEGWEELEDNEK 174
R +++ +EL W++ + +K
4dqy_A: 81 GHSIRHPDVEVDGFSELR-WDDQQKVKK 107
dssp: ------HHHHEE------ HHHHHHHHH