Interaction between Poly [ADP-ribose] polymerase 1 (4dqy_A) and Poly [ADP-ribose] polymerase 1 (4dqy_C)

PDB and SCOP data

PDB ID: 4dqy (all binary interactions in this PDB entry)

Title: Structure of Human PARP-1 bound to a DNA double strand break

Release date: 2012-05-30

Resolution: 3.2 Å

  • Chain A: 4dqy_A

    Title: Poly [ADP-ribose] polymerase 1

    Source organism: Homo sapiens

    Number of residues: 116 (30 missing in structure)

  • Chain B: 4dqy_C

    Title: Poly [ADP-ribose] polymerase 1

    Source organism: Homo sapiens

    Number of residues: 506 (50 missing in structure)

Buried interface area: 256.30 Å2

Number of inter-residue contacts at the interface: 20

Number of H-bonds: 5

Number of salt bridges: 1

  • Pairwise interaction

  • Biological assembly

    Heteromer, 3 proteins, 1 nucleic acid.


  • Interface residues in 4dqy_A

    No. Residue no. in structure Residue no. in sequence Residue name Buried ASA, Å2 Buried ASA, %
    1 40 60 Q 41.5 44.9 %
    2 41 61 S 7.5 53.8 %
    3 42 62 P 33.5 26.4 %
    4 43 63 M 55.6 33.7 %
    5 44 64 F 31.5 25.4 %
    6 45 65 D 86.6 79.1 %

  • Interface residues in 4dqy_C

    No. Residue no. in structure Residue no. in sequence Residue name Buried ASA, Å2 Buried ASA, %
    1 566 50 T 17.5 52.9 %
    2 567 51 N 6.7 70.6 %
    3 568 52 S 18.5 60.2 %
    4 589 73 W 29.9 31.2 %
    5 590 74 G 11.1 82.1 %
    6 591 75 R 34.4 75.7 %
    7 595 79 V 4.5 2.9 %
    8 596 80 I 58.7 75.1 %
    9 597 81 G 29.6 63.7 %
    10 598 82 S 26.8 44.1 %
    11 746 230 M 18.7 15.6 %

No. Residue no. in chain A structure Residue no. in chain A sequence Residue in chain A Residue no. in chain B structure Residue no. in chain B sequence Residue in chain B Contact area, Å2 Contact type
1 40 60 Q 591 75 R 4.0
2 40 60 Q 596 80 I 18.8
3 40 60 Q 746 230 M 18.7
4 41 61 S 596 80 I 7.5
5 42 62 P 595 79 V 4.5
6 42 62 P 596 80 I 17.2
7 42 62 P 597 81 G 11.9 H-bond
8 43 63 M 589 73 W 15.1 H-bond
9 43 63 M 597 81 G 13.7
10 43 63 M 598 82 S 26.8
11 44 64 F 589 73 W 14.8
12 44 64 F 590 74 G 3.5
13 44 64 F 596 80 I 9.3
14 44 64 F 597 81 G 3.9
15 45 65 D 566 50 T 17.5
16 45 65 D 567 51 N 6.7 H-bond
17 45 65 D 568 52 S 18.5 H-bond
18 45 65 D 590 74 G 7.6
19 45 65 D 591 75 R 30.4 H-bond, Salt bridge
20 45 65 D 596 80 I 5.9

  • Query protein: sp|P49916|DNLI3_HUMAN DNA ligase 3 OS=Homo sapiens GN=LIG3 PE=1 SV=2

    Result domain: 4dqy_A; Poly [ADP-ribose] polymerase 1

    Alignment data:

    Expectation value = 3.15e-6, Score = 50 bits (118),

    Identities = 31% (27/88), Positive = 53% (47/88), Gaps = 3% (3/88).

    Interface alignment data:

    Interface residues in alignment: 100% (6/6).

    Identities = 17% (1/6), Positive = 50% (3/6), Gaps = 0% (0/6).

    Query: 87 EMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRIGKVVPNPFSESGGDMKEWYHIKCMFEK 146

    E +++ + V+YAK G A CKKC E I K R+ +V +P + G + WYH C ++

    4dqy_A: 23 ESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFD--GKVPHWYHFSCFWKV 80

    dssp: ---EEEEE------E------E-----EEEEEEEE----- -EEEEEEE--HHHH-


    Query: 147 LERARATTKKIEDLTELEGWEELEDNEK 174

    R +++ +EL W++ + +K

    4dqy_A: 81 GHSIRHPDVEVDGFSELR-WDDQQKVKK 107

    dssp: ------HHHHEE------ HHHHHHHHH