Interaction between DNA ligase 3 alpha (6wh1_B) and X-ray repair cross complementing protein 1 variant (6wh1_A)

PDB and SCOP data

PDB ID: 6wh1 (all binary interactions in this PDB entry)

Title: Structure of the complex of human DNA ligase III-alpha and XRCC1 BRCT domains

Release date: 2020-12-02

Resolution: 2.4 Å

  • Chain A: 6wh1_B

    Title: DNA ligase 3 alpha

    Source organism: Homo sapiens

    Number of residues: 78 (1 missing in structure)

  • Chain B: 6wh1_A

    Title: X-ray repair cross complementing protein 1 variant

    Source organism: Homo sapiens

    Number of residues: 96 (1 missing in structure)

Buried interface area: 568.90 Å2

Number of inter-residue contacts at the interface: 45

Number of H-bonds: 8

Number of salt bridges: 4

  • Pairwise interaction

  • Biological assembly

    Heteromer, 2 proteins.


  • Interface residues in 6wh1_B

    No. Residue no. in structure Residue no. in sequence Residue name Buried ASA, Å2 Buried ASA, %
    1 846 2 V 54.3 43.8 %
    2 847 3 L 91.8 87.3 %
    3 848 4 L 5.3 6.0 %
    4 849 5 D 16.8 14.7 %
    5 852 8 T 0.9 1.1 %
    6 867 23 R 8.0 6.7 %
    7 869 25 R 31.9 31.1 %
    8 870 26 R 103.3 75.3 %
    9 871 27 Y 50.6 90.9 %
    10 873 29 V 48.2 79.2 %
    11 874 30 A 41.8 100.0 %
    12 875 31 F 21.4 65.7 %
    13 876 32 D 52.9 86.4 %
    14 877 33 G 7.3 72.0 %
    15 878 34 D 29.3 37.1 %
    16 913 69 I 5.0 16.7 %

  • Interface residues in 6wh1_A

    No. Residue no. in structure Residue no. in sequence Residue name Buried ASA, Å2 Buried ASA, %
    1 538 1 E 44.5 20.7 %
    2 539 2 L 99.2 91.1 %
    3 540 3 P 13.6 29.9 %
    4 541 4 D 7.8 7.7 %
    5 560 23 R 64.9 43.6 %
    6 563 26 I 13.7 17.5 %
    7 564 27 R 106.3 84.6 %
    8 565 28 Y 15.5 46.8 %
    9 567 30 T 64.9 95.1 %
    10 568 31 A 40.0 100.0 %
    11 569 32 F 13.8 100.0 %
    12 570 33 N 31.6 34.9 %
    13 571 34 G <0.1 0.5 %
    14 573 36 L 6.4 11.1 %
    15 616 79 N 12.6 31.2 %
    16 619 82 Q 33.8 40.0 %

No. Residue no. in chain A structure Residue no. in chain A sequence Residue in chain A Residue no. in chain B structure Residue no. in chain B sequence Residue in chain B Contact area, Å2 Contact type
1 846 2 V 538 1 E 6.4
2 846 2 V 539 2 L 10.0
3 846 2 V 540 3 P 7.0
4 846 2 V 569 32 F <0.1
5 846 2 V 619 82 Q 30.9
6 847 3 L 539 2 L 14.3
7 847 3 L 540 3 P 0.2
8 847 3 L 564 27 R 20.3
9 847 3 L 565 28 Y 15.5
10 847 3 L 568 31 A 13.2
11 847 3 L 569 32 F 12.8
12 847 3 L 616 79 N 12.6
13 847 3 L 619 82 Q 2.9
14 848 4 L 564 27 R 5.3
15 849 5 D 564 27 R 16.8 H-bond, Salt bridge
16 852 8 T 560 23 R 0.9
17 867 23 R 538 1 E 8.0
18 869 25 R 563 26 I 2.0
19 869 25 R 567 30 T 23.4
20 869 25 R 571 34 G <0.1
21 869 25 R 573 36 L 6.4
22 870 26 R 539 2 L 19.8
23 870 26 R 540 3 P 6.4 H-bond
24 870 26 R 541 4 D 7.8
25 870 26 R 567 30 T 24.3
26 870 26 R 568 31 A 12.4 H-bond
27 870 26 R 569 32 F 1.0
28 870 26 R 570 33 N 31.6
29 871 27 Y 538 1 E 20.8
30 871 27 Y 539 2 L 29.8 H-bond
31 873 29 V 563 26 I 11.7
32 873 29 V 564 27 R 19.8
33 873 29 V 567 30 T 16.7
34 874 30 A 539 2 L 10.1
35 874 30 A 564 27 R 16.7 H-bond
36 874 30 A 567 30 T 0.6
37 874 30 A 568 31 A 14.4
38 875 31 F 538 1 E 4.3
39 875 31 F 539 2 L 15.2
40 875 31 F 564 27 R 1.9
41 876 32 D 560 23 R 27.4 H-bond, Salt bridge
42 876 32 D 564 27 R 25.5 H-bond, Salt bridge
43 877 33 G 560 23 R 7.3
44 878 34 D 560 23 R 29.3 H-bond, Salt bridge
45 913 69 I 538 1 E 5.0

  • Query protein: sp|P49916|DNLI3_HUMAN DNA ligase 3 OS=Homo sapiens GN=LIG3 PE=1 SV=2

    Result domain: 6wh1_B; DNA ligase 3 alpha

    Alignment data:

    Expectation value = 3.73e-47, Score = 165 bits (417),

    Identities = 100% (77/77), Positive = 100% (77/77), Gaps = 0% (0/77).

    Interface alignment data:

    Interface residues in alignment: 100% (16/16).

    Identities = 100% (16/16), Positive = 100% (16/16), Gaps = 0% (0/16).

    Query: 932 KVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSRDKNPAAQQV 991

    KVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSRDKNPAAQQV

    6wh1_B: 1 KVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSRDKNPAAQQV 60

    dssp: ----------EEE-------HHHHHHHHHH---EE--HHH-----EEE---------EEE


    Query: 992 SPEWIWACIRKRRLVAP 1008

    SPEWIWACIRKRRLVAP

    6wh1_B: 61 SPEWIWACIRKRRLVAP 77

    dssp: -HHHHHHHHHH------