Interaction between DNA ligase 3 (3pc7_B) and DNA ligase 3 (3pc7_B)

PDB and SCOP data

PDB ID: 3pc7 (all binary interactions in this PDB entry)

Title: X-ray crystal structure of the DNA ligase III-alpha BRCT domain.

Release date: 2011-06-15

Resolution: 1.6 Å

  • Chain A: 3pc7_B

    Title: DNA ligase 3

    Source organism: Homo sapiens

    Number of residues: 88 (11 missing in structure)

    SCOP family: c.15.1.2

  • Chain B: 3pc7_B

    Title: DNA ligase 3

    Source organism: Homo sapiens

    Number of residues: 88 (11 missing in structure)

    SCOP family: c.15.1.2

Buried interface area: 547.68 Å2

Number of inter-residue contacts at the interface: 46

Number of H-bonds: 10

Number of salt bridges: 6

  • Pairwise interaction

  • Biological assembly

    Homomer, 2 proteins, 2 domains.


  • Interface residues in 3pc7_B

    No. Residue no. in structure Residue no. in sequence Residue name Buried ASA, Å2 Buried ASA, %
    1 846 12 V 0.7 0.3 %
    2 847 13 L 93.1 79.8 %
    3 848 14 L 6.3 9.7 %
    4 849 15 D 14.3 12.8 %
    5 860 26 P 8.7 9.2 %
    6 865 31 F <0.1 0.2 %
    7 866 32 S 0.6 0.8 %
    8 869 35 R 69.5 82.1 %
    9 870 36 R 111.8 76.8 %
    10 871 37 Y 28.9 31.9 %
    11 873 39 V 57.4 96.9 %
    12 874 40 A 41.0 100.0 %
    13 875 41 F 16.8 51.3 %
    14 876 42 D 27.3 37.9 %
    15 877 43 G 5.1 44.1 %
    16 878 44 D 18.3 25.8 %
    17 879 45 L 39.1 59.3 %
    18 881 47 Q 2.5 6.0 %
    19 883 49 F 6.2 3.3 %

  • Interface residues in 3pc7_B

    No. Residue no. in structure Residue no. in sequence Residue name Buried ASA, Å2 Buried ASA, %
    1 846 12 V 0.7 0.3 %
    2 847 13 L 93.1 79.8 %
    3 848 14 L 6.3 9.7 %
    4 849 15 D 14.3 12.8 %
    5 860 26 P 8.7 9.2 %
    6 865 31 F <0.1 0.2 %
    7 866 32 S 0.6 0.8 %
    8 869 35 R 69.5 82.1 %
    9 870 36 R 111.8 76.8 %
    10 871 37 Y 28.9 31.9 %
    11 873 39 V 57.4 96.9 %
    12 874 40 A 41.0 100.0 %
    13 875 41 F 16.8 51.2 %
    14 876 42 D 27.3 37.9 %
    15 877 43 G 5.1 44.0 %
    16 878 44 D 18.3 25.8 %
    17 879 45 L 39.1 59.3 %
    18 881 47 Q 2.5 6.0 %
    19 883 49 F 6.2 3.3 %

No. Residue no. in chain A structure Residue no. in chain A sequence Residue in chain A Residue no. in chain B structure Residue no. in chain B sequence Residue in chain B Contact area, Å2 Contact type
1 846 12 V 871 37 Y 0.7
2 847 13 L 847 13 L 11.6
3 847 13 L 870 36 R 26.5
4 847 13 L 871 37 Y 28.2
5 847 13 L 874 40 A 11.4
6 847 13 L 875 41 F 15.4
7 848 14 L 870 36 R 6.3 H-bond
8 849 15 D 870 36 R 14.3 H-bond, Salt bridge
9 860 26 P 881 47 Q 2.5
10 860 26 P 883 49 F 6.2
11 865 31 F 878 44 D <0.1
12 866 32 S 878 44 D 0.6
13 869 35 R 873 39 V 17.4
14 869 35 R 877 43 G 5.1
15 869 35 R 878 44 D 17.7 H-bond, Salt bridge
16 869 35 R 879 45 L 29.3 H-bond
17 870 36 R 847 13 L 26.5
18 870 36 R 848 14 L 6.3 H-bond
19 870 36 R 849 15 D 14.3 H-bond, Salt bridge
20 870 36 R 873 39 V 21.9
21 870 36 R 874 40 A 14.1 H-bond
22 870 36 R 875 41 F 1.4
23 870 36 R 876 42 D 27.3 Salt bridge
24 871 37 Y 846 12 V 0.7
25 871 37 Y 847 13 L 28.2
26 873 39 V 869 35 R 17.4
27 873 39 V 870 36 R 21.9
28 873 39 V 873 39 V 17.7
29 873 39 V 874 40 A 0.3
30 873 39 V 879 45 L 0.1
31 874 40 A 847 13 L 11.4
32 874 40 A 870 36 R 14.1 H-bond
33 874 40 A 873 39 V 0.3
34 874 40 A 874 40 A 15.2
35 875 41 F 847 13 L 15.4
36 875 41 F 870 36 R 1.4
37 876 42 D 870 36 R 27.3 Salt bridge
38 877 43 G 869 35 R 5.1
39 878 44 D 865 31 F <0.1
40 878 44 D 866 32 S 0.6
41 878 44 D 869 35 R 17.7 H-bond, Salt bridge
42 879 45 L 869 35 R 29.3 H-bond
43 879 45 L 873 39 V 0.1
44 879 45 L 879 45 L 9.7
45 881 47 Q 860 26 P 2.5
46 883 49 F 860 26 P 6.2

  • Query protein: sp|P49916|DNLI3_HUMAN DNA ligase 3 OS=Homo sapiens GN=LIG3 PE=1 SV=2

    Result domain: 3pc7_B; DNA ligase 3

    Alignment data:

    Expectation value = 4.10e-52, Score = 180 bits (455),

    Identities = 98% (84/86), Positive = 99% (85/86), Gaps = 0% (0/86).

    Interface alignment data:

    Interface residues in alignment: 100% (19/19).

    Identities = 100% (19/19), Positive = 100% (19/19), Gaps = 0% (0/19).

    Query: 923 AADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSR 982

    +ADETL QTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSR

    3pc7_B: 2 SADETLSQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSR 61

    dssp: ---------EE--------HHHHHHHHHH---EE--HHHHHH--EE----


    Query: 983 DKNPAAQQVSPEWIWACIRKRRLVAP 1008

    DKNPAAQQVSPEWIWACIRKRRLVAP

    3pc7_B: 62 DKNPAAQQVSPEWIWACIRKRRLVAP 87

    dssp: ------EE--HHHHHHHHHH------