Interaction between DNA ligase 3 (3pc8_C) and DNA repair protein XRCC1 (3pc8_A)

PDB and SCOP data

PDB ID: 3pc8 (all binary interactions in this PDB entry)

Title: X-ray crystal structure of the heterodimeric complex of XRCC1 and DNA ligase III-alpha BRCT domains.

Release date: 2011-06-15

Resolution: 2.3 Å

  • Chain A: 3pc8_C

    Title: DNA ligase 3

    Source organism: Homo sapiens

    Number of residues: 88 (11 missing in structure)

    SCOP family: c.15.1.2

  • Chain B: 3pc8_A

    Title: DNA repair protein XRCC1

    Source organism: Mus musculus

    Number of residues: 98 (1 missing in structure)

    SCOP family: c.15.1.1

Buried interface area: 613.89 Å2

Number of inter-residue contacts at the interface: 46

Number of H-bonds: 9

Number of salt bridges: 5

  • Pairwise interaction

  • Biological assembly

    Heteromer, 4 proteins, 4 domains.


  • Interface residues in 3pc8_C

    No. Residue no. in structure Residue no. in sequence Residue name Buried ASA, Å2 Buried ASA, %
    1 846 12 V 12.0 6.1 %
    2 847 13 L 90.1 74.1 %
    3 848 14 L 7.7 10.0 %
    4 849 15 D 16.6 14.8 %
    5 852 18 T 2.5 2.7 %
    6 853 19 G 4.2 6.6 %
    7 867 33 R 27.0 24.0 %
    8 869 35 R 31.8 30.4 %
    9 870 36 R 107.5 76.1 %
    10 871 37 Y 58.3 90.3 %
    11 873 39 V 50.4 79.9 %
    12 874 40 A 45.1 100.0 %
    13 875 41 F 30.5 85.4 %
    14 876 42 D 55.3 81.3 %
    15 877 43 G 3.2 47.7 %
    16 878 44 D 33.5 47.6 %
    17 910 76 W 11.8 18.4 %
    18 913 79 I 19.7 75.9 %
    19 914 80 R 6.7 3.9 %

  • Interface residues in 3pc8_A

    No. Residue no. in structure Residue no. in sequence Residue name Buried ASA, Å2 Buried ASA, %
    1 534 1 M 22.3 14.8 %
    2 535 2 P 81.8 68.0 %
    3 536 3 E 6.1 5.8 %
    4 537 4 L 94.5 79.1 %
    5 538 5 P 5.0 9.2 %
    6 539 6 D 9.8 11.4 %
    7 558 25 R 75.1 45.6 %
    8 561 28 I 13.5 18.2 %
    9 562 29 R 109.5 75.8 %
    10 563 30 Y 15.7 38.6 %
    11 565 32 T 56.8 81.2 %
    12 566 33 A 39.1 100.0 %
    13 567 34 F 16.6 97.6 %
    14 568 35 N 30.4 39.8 %
    15 570 37 E 18.6 21.7 %
    16 614 81 N 9.4 23.2 %
    17 617 84 Q 9.7 11.2 %

No. Residue no. in chain A structure Residue no. in chain A sequence Residue in chain A Residue no. in chain B structure Residue no. in chain B sequence Residue in chain B Contact area, Å2 Contact type
1 846 12 V 537 4 L 2.4
2 846 12 V 617 84 Q 9.7
3 847 13 L 537 4 L 14.2
4 847 13 L 538 5 P <0.1
5 847 13 L 562 29 R 25.1
6 847 13 L 563 30 Y 15.7
7 847 13 L 566 33 A 10.5
8 847 13 L 567 34 F 15.0
9 847 13 L 614 81 N 9.4
10 847 13 L 617 84 Q <0.1
11 848 14 L 535 2 P 1.4
12 848 14 L 562 29 R 6.3 H-bond
13 849 15 D 562 29 R 16.6 H-bond, Salt bridge
14 852 18 T 558 25 R 2.5
15 853 19 G 558 25 R 4.2
16 867 33 R 534 1 M 15.6
17 867 33 R 535 2 P 11.4
18 869 35 R 565 32 T 13.2
19 869 35 R 570 37 E 18.6 Salt bridge
20 870 36 R 537 4 L 23.3
21 870 36 R 538 5 P 5.0 H-bond
22 870 36 R 539 6 D 9.8
23 870 36 R 565 32 T 23.6
24 870 36 R 566 33 A 13.9 H-bond
25 870 36 R 567 34 F 1.6
26 870 36 R 568 35 N 30.4
27 871 37 Y 535 2 P 24.4 H-bond
28 871 37 Y 536 3 E 6.1
29 871 37 Y 537 4 L 27.8 H-bond
30 873 39 V 561 28 I 13.5
31 873 39 V 562 29 R 18.2
32 873 39 V 565 32 T 18.7
33 874 40 A 537 4 L 11.4
34 874 40 A 562 29 R 17.7 H-bond
35 874 40 A 565 32 T 1.3
36 874 40 A 566 33 A 14.7
37 875 41 F 535 2 P 13.2
38 875 41 F 537 4 L 15.4
39 875 41 F 562 29 R 2.0
40 876 42 D 558 25 R 31.6 H-bond, Salt bridge
41 876 42 D 562 29 R 23.6 Salt bridge
42 877 43 G 558 25 R 3.2
43 878 44 D 558 25 R 33.5 H-bond, Salt bridge
44 910 76 W 535 2 P 11.8
45 913 79 I 535 2 P 19.7
46 914 80 R 534 1 M 6.7

  • Query protein: sp|P49916|DNLI3_HUMAN DNA ligase 3 OS=Homo sapiens GN=LIG3 PE=1 SV=2

    Result domain: 3pc8_C; DNA ligase 3

    Alignment data:

    Expectation value = 4.10e-52, Score = 180 bits (455),

    Identities = 98% (84/86), Positive = 99% (85/86), Gaps = 0% (0/86).

    Interface alignment data:

    Interface residues in alignment: 100% (19/19).

    Identities = 100% (19/19), Positive = 100% (19/19), Gaps = 0% (0/19).

    Query: 923 AADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSR 982

    +ADETL QTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSR

    3pc8_C: 2 SADETLSQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSR 61

    dssp: ---------EEE-------HHHHHHHHHH---EE--HHHHHH--EEE---


    Query: 983 DKNPAAQQVSPEWIWACIRKRRLVAP 1008

    DKNPAAQQVSPEWIWACIRKRRLVAP

    3pc8_C: 62 DKNPAAQQVSPEWIWACIRKRRLVAP 87

    dssp: ------EEE-HHHHHHHHHH------