Interaction between DNA ligase 3 (3pc7_A) and DNA ligase 3 (3pc7_A)

PDB and SCOP data

PDB ID: 3pc7 (all binary interactions in this PDB entry)

Title: X-ray crystal structure of the DNA ligase III-alpha BRCT domain.

Release date: 2011-06-15

Resolution: 1.6 Å

  • Chain A: 3pc7_A

    Title: DNA ligase 3

    Source organism: Homo sapiens

    Number of residues: 88 (7 missing in structure)

    SCOP family: c.15.1.2

  • Chain B: 3pc7_A

    Title: DNA ligase 3

    Source organism: Homo sapiens

    Number of residues: 88 (7 missing in structure)

    SCOP family: c.15.1.2

Buried interface area: 708.90 Å2

Number of inter-residue contacts at the interface: 48

Number of H-bonds: 6

Number of salt bridges: 4

  • Pairwise interaction

  • Biological assembly

    Homomer, 2 proteins, 2 domains.


  • Interface residues in 3pc7_A

    No. Residue no. in structure Residue no. in sequence Residue name Buried ASA, Å2 Buried ASA, %
    1 843 9 Q 19.9 25.0 %
    2 844 10 T 7.5 6.7 %
    3 845 11 K 73.9 41.0 %
    4 846 12 V 14.5 12.7 %
    5 847 13 L 92.9 88.7 %
    6 848 14 L 6.0 8.6 %
    7 849 15 D 15.7 14.6 %
    8 869 35 R 53.2 45.8 %
    9 870 36 R 108.0 79.1 %
    10 871 37 Y 57.7 72.6 %
    11 873 39 V 64.8 97.1 %
    12 874 40 A 39.2 100.0 %
    13 875 41 F 21.8 51.7 %
    14 876 42 D 27.3 39.7 %
    15 877 43 G 3.4 25.5 %
    16 879 45 L 16.5 31.9 %
    17 913 79 I 19.7 65.5 %
    18 914 80 R 35.1 20.3 %
    19 916 82 R 31.7 20.8 %

  • Interface residues in 3pc7_A

    No. Residue no. in structure Residue no. in sequence Residue name Buried ASA, Å2 Buried ASA, %
    1 843 9 Q 19.9 24.9 %
    2 844 10 T 7.5 6.7 %
    3 845 11 K 73.9 41.0 %
    4 846 12 V 14.5 12.7 %
    5 847 13 L 92.9 88.7 %
    6 848 14 L 6.0 8.6 %
    7 849 15 D 15.8 14.6 %
    8 869 35 R 53.2 45.9 %
    9 870 36 R 108.0 79.2 %
    10 871 37 Y 57.7 72.6 %
    11 873 39 V 64.8 97.1 %
    12 874 40 A 39.2 100.0 %
    13 875 41 F 21.8 51.7 %
    14 876 42 D 27.3 39.7 %
    15 877 43 G 3.4 25.5 %
    16 879 45 L 16.5 31.9 %
    17 913 79 I 19.7 65.5 %
    18 914 80 R 35.1 20.3 %
    19 916 82 R 31.7 20.8 %

No. Residue no. in chain A structure Residue no. in chain A sequence Residue in chain A Residue no. in chain B structure Residue no. in chain B sequence Residue in chain B Contact area, Å2 Contact type
1 843 9 Q 916 82 R 19.9
2 844 10 T 916 82 R 7.5
3 845 11 K 871 37 Y 11.2
4 845 11 K 875 41 F 3.5
5 845 11 K 913 79 I 19.7
6 845 11 K 914 80 R 35.1
7 845 11 K 916 82 R 4.2
8 846 12 V 871 37 Y 14.5
9 847 13 L 847 13 L 13.0
10 847 13 L 870 36 R 20.4
11 847 13 L 871 37 Y 32.0 H-bond
12 847 13 L 874 40 A 11.4
13 847 13 L 875 41 F 16.1
14 848 14 L 870 36 R 6.0
15 849 15 D 870 36 R 15.7 H-bond, Salt bridge
16 869 35 R 869 35 R 9.1
17 869 35 R 873 39 V 24.2
18 869 35 R 877 43 G 3.4
19 869 35 R 879 45 L 16.5
20 870 36 R 847 13 L 20.4
21 870 36 R 848 14 L 6.0
22 870 36 R 849 15 D 15.8 H-bond, Salt bridge
23 870 36 R 873 39 V 22.3
24 870 36 R 874 40 A 14.0 H-bond
25 870 36 R 875 41 F 2.2
26 870 36 R 876 42 D 27.3 Salt bridge
27 871 37 Y 845 11 K 11.2
28 871 37 Y 846 12 V 14.5
29 871 37 Y 847 13 L 32.0 H-bond
30 873 39 V 869 35 R 24.2
31 873 39 V 870 36 R 22.3
32 873 39 V 873 39 V 18.1
33 873 39 V 874 40 A 0.2
34 874 40 A 847 13 L 11.4
35 874 40 A 870 36 R 14.0 H-bond
36 874 40 A 873 39 V 0.2
37 874 40 A 874 40 A 13.6
38 875 41 F 845 11 K 3.5
39 875 41 F 847 13 L 16.1
40 875 41 F 870 36 R 2.2
41 876 42 D 870 36 R 27.3 Salt bridge
42 877 43 G 869 35 R 3.4
43 879 45 L 869 35 R 16.5
44 913 79 I 845 11 K 19.7
45 914 80 R 845 11 K 35.1
46 916 82 R 843 9 Q 19.9
47 916 82 R 844 10 T 7.5
48 916 82 R 845 11 K 4.2

  • Query protein: sp|P49916|DNLI3_HUMAN DNA ligase 3 OS=Homo sapiens GN=LIG3 PE=1 SV=2

    Result domain: 3pc7_A; DNA ligase 3

    Alignment data:

    Expectation value = 4.10e-52, Score = 180 bits (455),

    Identities = 98% (84/86), Positive = 99% (85/86), Gaps = 0% (0/86).

    Interface alignment data:

    Interface residues in alignment: 100% (19/19).

    Identities = 100% (19/19), Positive = 100% (19/19), Gaps = 0% (0/19).

    Query: 923 AADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSR 982

    +ADETL QTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSR

    3pc7_A: 2 SADETLSQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSR 61

    dssp: -------------EE--------HHHHHHHHHH---EE--HHHHHH--EEE---


    Query: 983 DKNPAAQQVSPEWIWACIRKRRLVAP 1008

    DKNPAAQQVSPEWIWACIRKRRLVAP

    3pc7_A: 62 DKNPAAQQVSPEWIWACIRKRRLVAP 87

    dssp: ------EEE-HHHHHHHHHH------