{"comer_search": {
  "program": "comer",
  "version": "2.03.03",
  "references": [
    "Margelevicius, M. (2020). COMER2: GPU-accelerated sensitive and specific homology searches. Bioinformatics 36, 3570-3572.",
    "Margelevicius, M. (2016). Bayesian nonparametrics in protein remote homology search. Bioinformatics 32, 2744-2752."
  ],
  "query": {
    "length": 105,
    "name": "",
    "description": "Q8RFG4_FUSNN\/1-107_cons. PF08921.13Domain of unknown function (DUF1904) [Reference consensus sequence]"
  },
  "database": {
    "names": [
      "swissprot90_2022_03",
      "pdb70_220717"
    ],
    "number_of_profiles": 390907,
    "number_of_positions": 143238575
  },
  "message": "Profiles found below the e-value threshold:",
  "search_summary": [
    {"summary_entry": {
      "description": "4M1A_A Hypothetical protein; PSI-Biology, New York Structural Genomics R...",
      "score": 97,
      "evalue": 5e-25
    }},
    {"summary_entry": {
      "description": "1U9D_B hypothetical protein VC0714; structural genomics, MCSG, hypotheti...",
      "score": 98,
      "evalue": 7.1e-25
    }},
    {"summary_entry": {
      "description": "sp|Q05354|HPCD_ECOLX 5-carboxymethyl-2-hydroxymuconate Delta-isomerase O...",
      "score": 80,
      "evalue": 7.9e-19
    }},
    {"summary_entry": {
      "description": "4NWP_F Uncharacterized protein; two-component, self-assembling, tetrahed...",
      "score": 78,
      "evalue": 2.3e-18
    }},
    {"summary_entry": {
      "description": "4DH4_A MIF; Trimer, ISOMERASE; 1.82A {Toxoplasma gondii} SCOP: d.80.1.0",
      "score": 74,
      "evalue": 1e-17
    }},
    {"summary_entry": {
      "description": "6VVR_B Tautomerase; symmetric, fused, 4-oxalocrotonate tautomerase, ISOM...",
      "score": 74,
      "evalue": 2.8e-17
    }},
    {"summary_entry": {
      "description": "1OTG_A 5-CARBOXYMETHYL-2-HYDROXYMUCONATE ISOMERASE; HYDROXYMUCONATE, ISO...",
      "score": 74,
      "evalue": 4.9e-17
    }},
    {"summary_entry": {
      "description": "sp|P90835|MIF3_CAEEL MIF-like protein mif-3 OS=Caenorhabditis elegans OX...",
      "score": 76,
      "evalue": 5.9e-17
    }},
    {"summary_entry": {
      "description": "sp|P81529|MIFH_TRISP Macrophage migration inhibitory factor homolog OS=T...",
      "score": 73,
      "evalue": 5.9e-17
    }},
    {"summary_entry": {
      "description": "7YXV_A Anthranilate synthase; cytosolic protein, tautomerase superfamily...",
      "score": 74,
      "evalue": 6.1e-17
    }},
    {"summary_entry": {
      "description": "sp|Q02960|MIF_CHICK Macrophage migration inhibitory factor OS=Gallus gal...",
      "score": 72,
      "evalue": 6.6e-17
    }},
    {"summary_entry": {
      "description": "3T5S_A Macrophage migration inhibitory factor; SSGCID, Structural Genomi...",
      "score": 73,
      "evalue": 8.5e-17
    }},
    {"summary_entry": {
      "description": "sp|Q76BK2|MIF_XENLA Macrophage migration inhibitory factor OS=Xenopus la...",
      "score": 71,
      "evalue": 9.9e-17
    }},
    {"summary_entry": {
      "description": "3E6Q_C putative 5-carboxymethyl-2-hydroxymuconate isomerase; structural ...",
      "score": 76,
      "evalue": 1.3e-16
    }},
    {"summary_entry": {
      "description": "sp|O34882|YOLI_BACSU Probable tautomerase YolI OS=Bacillus subtilis (str...",
      "score": 73,
      "evalue": 1.4e-16
    }},
    {"summary_entry": {
      "description": "sp|Q640C5|DOPDB_XENLA D-dopachrome decarboxylase-B OS=Xenopus laevis OX=...",
      "score": 71,
      "evalue": 1.6e-16
    }},
    {"summary_entry": {
      "description": "1UIZ_B Macrophage Migration Inhibitory Factor; Cytokine, Tautomerase, Ma...",
      "score": 71,
      "evalue": 1.6e-16
    }},
    {"summary_entry": {
      "description": "5UNQ_B Putative tautomerase; 4-Oxalocrotonate tautomerase, MIF, cisCaaD,...",
      "score": 72,
      "evalue": 1.7e-16
    }},
    {"summary_entry": {
      "description": "sp|P81748|MIFH_TRITR Macrophage migration inhibitory factor homolog OS=T...",
      "score": 73,
      "evalue": 2.3e-16
    }},
    {"summary_entry": {
      "description": "4LKB_D hypothetical protein alr4568\/putative 4-Oxalocrotonate Tautomera...",
      "score": 75,
      "evalue": 2.7e-16
    }},
    {"summary_entry": {
      "description": "5UIF_A Ps01740; 4-oxalocrotonate-Tautomerase, MIF, cis-Caad, dehalogenas...",
      "score": 73,
      "evalue": 2.7e-16
    }},
    {"summary_entry": {
      "description": "4JCU_B 5-carboxymethyl-2-hydroxymuconate isomerase; Structural Genomics,...",
      "score": 75,
      "evalue": 3.4e-16
    }},
    {"summary_entry": {
      "description": "sp|P30046|DOPD_HUMAN D-dopachrome decarboxylase OS=Homo sapiens OX=9606 ...",
      "score": 70,
      "evalue": 3.8e-16
    }},
    {"summary_entry": {
      "description": "6VVN_B 4-oxalocrotonate tautomerase; asymmetric, fused, 4-oxalocrotonate...",
      "score": 72,
      "evalue": 4.1e-16
    }},
    {"summary_entry": {
      "description": "sp|Q28J83|DOPD_XENTR D-dopachrome decarboxylase OS=Xenopus tropicalis OX...",
      "score": 70,
      "evalue": 4.5e-16
    }},
    {"summary_entry": {
      "description": "sp|O32183|YUSQ_BACSU Probable tautomerase YusQ OS=Bacillus subtilis (str...",
      "score": 71,
      "evalue": 4.6e-16
    }},
    {"summary_entry": {
      "description": "6B1K_B Macrophage migration inhibitory factor; CD74 BINDING, TAUTOMERASE...",
      "score": 70,
      "evalue": 4.7e-16
    }},
    {"summary_entry": {
      "description": "sp|A9JSE7|MIF_XENTR Macrophage migration inhibitory factor OS=Xenopus tr...",
      "score": 70,
      "evalue": 4.9e-16
    }},
    {"summary_entry": {
      "description": "2XCZ_A POSSIBLE ATLS1-LIKE LIGHT-INDUCIBLE PROTEIN; CYTOKINE, TAUTOMERAS...",
      "score": 70,
      "evalue": 5.1e-16
    }},
    {"summary_entry": {
      "description": "sp|Q18785|MIF2_CAEEL MIF-like protein mif-2 OS=Caenorhabditis elegans OX...",
      "score": 71,
      "evalue": 8e-16
    }},
    {"summary_entry": {
      "description": "sp|O55052|MIF_MERUN Macrophage migration inhibitory factor OS=Meriones u...",
      "score": 69,
      "evalue": 9.1e-16
    }},
    {"summary_entry": {
      "description": "2OS5_D AceMIF; macrophage migration inhibitory factor, cytokine, nematod...",
      "score": 70,
      "evalue": 9.2e-16
    }},
    {"summary_entry": {
      "description": "3C6V_A Probable tautomerase\/dehalogenase AU4130; Aspergillus fumigatus ...",
      "score": 76,
      "evalue": 1e-15
    }},
    {"summary_entry": {
      "description": "sp|A5PK65|DOPD_BOVIN D-dopachrome decarboxylase OS=Bos taurus OX=9913 GN...",
      "score": 69,
      "evalue": 1.1e-15
    }},
    {"summary_entry": {
      "description": "6VVW_C Tautomerase; symmetric, fused, 4-oxalocrotonate tautomerase, ISOM...",
      "score": 70,
      "evalue": 1.5e-15
    }},
    {"summary_entry": {
      "description": "7MW7_A D-dopachrome decarboxylase; Mitogen inhibitory factor 2, Mutant, ...",
      "score": 68,
      "evalue": 2e-15
    }},
    {"summary_entry": {
      "description": "3FWU_A Macrophage migration inhibitory factor-like protein; homotrimer, ...",
      "score": 70,
      "evalue": 2.8e-15
    }},
    {"summary_entry": {
      "description": "6CUQ_B Macrophage migration inhibitory factor-like protein; SSGCID, Stru...",
      "score": 67,
      "evalue": 3.3e-15
    }},
    {"summary_entry": {
      "description": "sp|O44786|MIFH_WUCBA Macrophage migration inhibitory factor homolog OS=W...",
      "score": 67,
      "evalue": 5e-15
    }},
    {"summary_entry": {
      "description": "7M58_A Tautomerase_3 domain-containing protein; HYDROLASE; HET: SO4; 2.4...",
      "score": 70,
      "evalue": 7.7e-15
    }},
    {"summary_entry": {
      "description": "4JJ9_A 5-carboxymethyl-2-hydroxymuconate delta-isomerase; NYSGRC, PSI-Bi...",
      "score": 73,
      "evalue": 8e-15
    }},
    {"summary_entry": {
      "description": "6LR3_I Macrophage migration inhibitory factor; Oncomelania hupensis macr...",
      "score": 68,
      "evalue": 9.4e-15
    }},
    {"summary_entry": {
      "description": "sp|O86237|Y138A_HAEIN Uncharacterized protein HI_1388.1 OS=Haemophilus i...",
      "score": 68,
      "evalue": 1.1e-14
    }},
    {"summary_entry": {
      "description": "3B64_A Macrophage migration inhibitory factor-like protein; CYTOKINE, LE...",
      "score": 66,
      "evalue": 1.2e-14
    }},
    {"summary_entry": {
      "description": "3MF7_A Cis-3-chloroacrylic acid dehalogenase; beta-alpha-beta motif, tau...",
      "score": 70,
      "evalue": 1.3e-14
    }},
    {"summary_entry": {
      "description": "7PUO_E 2-hydroxymuconate tautomerase,Chains: A,B,C,D,E,F,2-hydroxymucona...",
      "score": 68,
      "evalue": 1.4e-14
    }},
    {"summary_entry": {
      "description": "1MWW_A HYPOTHETICAL PROTEIN HI1388.1; I1388.1, STRUCTURAL GENOMICS, HYPO...",
      "score": 67,
      "evalue": 1.6e-14
    }},
    {"summary_entry": {
      "description": "sp|P94502|YRDN_BACSU Probable tautomerase YrdN OS=Bacillus subtilis (str...",
      "score": 66,
      "evalue": 1.7e-14
    }},
    {"summary_entry": {
      "description": "sp|Q5ZMG0|DOPD_CHICK D-dopachrome decarboxylase OS=Gallus gallus OX=9031...",
      "score": 66,
      "evalue": 1.7e-14
    }},
    {"summary_entry": {
      "description": "sp|O35215|DOPD_MOUSE D-dopachrome decarboxylase OS=Mus musculus OX=10090...",
      "score": 66,
      "evalue": 1.8e-14
    }},
    {"summary_entry": {
      "description": "3FWT_A Macrophage migration inhibitory factor-like protein; homotrimer, ...",
      "score": 67,
      "evalue": 1.9e-14
    }},
    {"summary_entry": {
      "description": "sp|A6NHG4|DDTL_HUMAN D-dopachrome decarboxylase-like protein OS=Homo sap...",
      "score": 68,
      "evalue": 2.7e-14
    }},
    {"summary_entry": {
      "description": "7MS0_A 4-oxalocrotonate tautomerase; tautomerase, HYDROLASE; 1.37A {Cory...",
      "score": 69,
      "evalue": 3.1e-14
    }},
    {"summary_entry": {
      "description": "2AAL_D Malonate Semialdehyde Decarboxylase; tautomerase superfamily beta...",
      "score": 66,
      "evalue": 3.8e-14
    }},
    {"summary_entry": {
      "description": "2WKB_D MACROPHAGE MIGRATION INHIBITORY FACTOR; CYTOKINE; HET: CME, GOL; ...",
      "score": 64,
      "evalue": 5.1e-14
    }},
    {"summary_entry": {
      "description": "1HFO_B MIGRATION INHIBITORY FACTOR; TAUTOMERASE; 1.65A {TRICHINELLA SPIR...",
      "score": 63,
      "evalue": 1.1e-13
    }},
    {"summary_entry": {
      "description": "4U5R_C RhCC; beta-alpha-beta structural motif, magnesium binding enzyme,...",
      "score": 66,
      "evalue": 3.8e-13
    }},
    {"summary_entry": {
      "description": "4LHP_J FG41 Malonate Semialdehyde Decarboxylase; The tautomerase Superfa...",
      "score": 63,
      "evalue": 7.3e-13
    }},
    {"summary_entry": {
      "description": "6BGN_F 2-hydroxymuconate tautomerase; ISOMERASE; HET: 6Y5, NO3, GOL; 1.5...",
      "score": 43,
      "evalue": 4.4e-08
    }},
    {"summary_entry": {
      "description": "4FDX_A 4-oxalocrotonase tautomerase isozyme; alpha\/beta barrel, 4OT, Ta...",
      "score": 44,
      "evalue": 4.7e-08
    }},
    {"summary_entry": {
      "description": "7M59_A Tautomerase domain-containing protein; ISOMERASE; 1.65A {Gammapro...",
      "score": 42,
      "evalue": 2e-07
    }},
    {"summary_entry": {
      "description": "2OPA_A Probable tautomerase ywhB; homohexamer, 4-Oxalocrotonate Tautomer...",
      "score": 41,
      "evalue": 3.5e-07
    }},
    {"summary_entry": {
      "description": "4FAZ_B 4-oxalocrotonate isomerase protein; alpha\/beta fold, Tautomerase...",
      "score": 41,
      "evalue": 3.9e-07
    }},
    {"summary_entry": {
      "description": "sp|Q8KRR5|4OT_PSEFL 2-hydroxymuconate tautomerase OS=Pseudomonas fluores...",
      "score": 40,
      "evalue": 1.1e-06
    }},
    {"summary_entry": {
      "description": "3MB2_A 4-oxalocrotonate tautomerase family enzyme - alpha subunit; TRANS...",
      "score": 41,
      "evalue": 1.2e-06
    }},
    {"summary_entry": {
      "description": "sp|P0DF84|Y797_STRP3 Probable tautomerase SpyM3_0797 OS=Streptococcus py...",
      "score": 39,
      "evalue": 1.7e-06
    }},
    {"summary_entry": {
      "description": "sp|Q89DI3|Y7456_BRADU Probable tautomerase bsl7456 OS=Bradyrhizobium dia...",
      "score": 40,
      "evalue": 1.8e-06
    }},
    {"summary_entry": {
      "description": "3EJ9_D Beta-subunit of trans-3-chloroacrylic acid dehalogenase; trans-3-...",
      "score": 40,
      "evalue": 2.1e-06
    }},
    {"summary_entry": {
      "description": "3M20_C 4-oxalocrotonate tautomerase, putative; 4-oxalocrotonate tautomer...",
      "score": 39,
      "evalue": 2.3e-06
    }},
    {"summary_entry": {
      "description": "3MB2_H 4-oxalocrotonate tautomerase family enzyme - beta subunit; TRANS-...",
      "score": 41,
      "evalue": 2.5e-06
    }},
    {"summary_entry": {
      "description": "sp|Q5HPH8|Y934_STAEQ Probable tautomerase SERP0934 OS=Staphylococcus epi...",
      "score": 39,
      "evalue": 3.3e-06
    }},
    {"summary_entry": {
      "description": "2X4K_A 4-OXALOCROTONATE TAUTOMERASE; ISOMERASE; HET: PO4; 1.1A {STAPHYLO...",
      "score": 38,
      "evalue": 3.5e-06
    }},
    {"summary_entry": {
      "description": "3M21_A Probable tautomerase HP_0924; 4-oxalocrotonate tautomerase, catal...",
      "score": 40,
      "evalue": 4.5e-06
    }},
    {"summary_entry": {
      "description": "sp|Q01468|4OT1_PSEPU 2-hydroxymuconate tautomerase OS=Pseudomonas putida...",
      "score": 38,
      "evalue": 5.3e-06
    }},
    {"summary_entry": {
      "description": "sp|P49172|4OT_PSEUF 2-hydroxymuconate tautomerase OS=Pseudomonas sp. (st...",
      "score": 38,
      "evalue": 6.8e-06
    }},
    {"summary_entry": {
      "description": "sp|Q8XRG1|Y4393_RALSO Probable tautomerase RSp0893 OS=Ralstonia solanace...",
      "score": 39,
      "evalue": 6.9e-06
    }},
    {"summary_entry": {
      "description": "3EJ9_E Alpha-subunit of trans-3-chloroacrylic acid dehalogenase; trans-3...",
      "score": 40,
      "evalue": 7.3e-06
    }},
    {"summary_entry": {
      "description": "sp|Q8XQR9|Y4651_RALSO Probable tautomerase RSp1151 OS=Ralstonia solanace...",
      "score": 38,
      "evalue": 7.3e-06
    }},
    {"summary_entry": {
      "description": "6OGM_C 4-oxalocrotonate tautomerase; HYDROLASE; HET: FMT, GOL; 1.865A {B...",
      "score": 39,
      "evalue": 9.3e-06
    }},
    {"summary_entry": {
      "description": "3RY0_B Putative tautomerase; 4 oxalocrotonate tautomerase family, tautom...",
      "score": 38,
      "evalue": 9.4e-06
    }},
    {"summary_entry": {
      "description": "sp|P45418|Y2002_DICD3 Probable tautomerase K2 OS=Dickeya dadantii (strai...",
      "score": 38,
      "evalue": 1e-05
    }},
    {"summary_entry": {
      "description": "sp|P67530|Y1017_STRPN Probable tautomerase SP_1017 OS=Streptococcus pneu...",
      "score": 38,
      "evalue": 1e-05
    }},
    {"summary_entry": {
      "description": "sp|Q4L670|Y1546_STAHJ Probable tautomerase SH1546 OS=Staphylococcus haem...",
      "score": 38,
      "evalue": 1.2e-05
    }},
    {"summary_entry": {
      "description": "sp|Q9ZI54|4OT_PSEST 2-hydroxymuconate tautomerase OS=Pseudomonas stutzer...",
      "score": 38,
      "evalue": 1.5e-05
    }},
    {"summary_entry": {
      "description": "sp|Q830C9|Y2859_ENTFA Probable tautomerase EF_2859 OS=Enterococcus faeca...",
      "score": 37,
      "evalue": 1.7e-05
    }},
    {"summary_entry": {
      "description": "sp|P70994|4OT_BACSU 2-hydroxymuconate tautomerase OS=Bacillus subtilis (...",
      "score": 37,
      "evalue": 2.5e-05
    }},
    {"summary_entry": {
      "description": "6OGM_K 4-oxalocrotonate tautomerase; HYDROLASE; HET: FMT, GOL; 1.865A {B...",
      "score": 36,
      "evalue": 2.8e-05
    }},
    {"summary_entry": {
      "description": "sp|Q9PIM5|Y270_CAMJE Probable tautomerase Cj0270 OS=Campylobacter jejuni...",
      "score": 37,
      "evalue": 2.8e-05
    }},
    {"summary_entry": {
      "description": "sp|Q49XG3|Y1389_STAS1 Probable tautomerase SSP1389 OS=Staphylococcus sap...",
      "score": 36,
      "evalue": 3.6e-05
    }},
    {"summary_entry": {
      "description": "sp|Q88WD0|Y1712_LACPL Probable tautomerase lp_1712 OS=Lactobacillus plan...",
      "score": 37,
      "evalue": 5.5e-05
    }},
    {"summary_entry": {
      "description": "3ABF_D 4-oxalocrotonate tautomerase; tautomerase, Isomerase; HET: SO4; 1...",
      "score": 36,
      "evalue": 9.7e-05
    }},
    {"summary_entry": {
      "description": "sp|P67526|Y1363_STAAM Probable tautomerase SAV1363 OS=Staphylococcus aur...",
      "score": 35,
      "evalue": 0.00016
    }},
    {"summary_entry": {
      "description": "sp|Q9K6B5|Y3814_ALKHC Probable tautomerase BH3814 OS=Alkalihalobacillus ...",
      "score": 35,
      "evalue": 0.00018
    }},
    {"summary_entry": {
      "description": "1GYX_B HYPOTHETICAL PROTEIN YDCE; TAUTOMERASE, ISOMERASE, HYPOTHETICAL P...",
      "score": 36,
      "evalue": 0.00023
    }},
    {"summary_entry": {
      "description": "sp|O25581|Y924_HELPY Probable tautomerase HP_0924 OS=Helicobacter pylori...",
      "score": 35,
      "evalue": 0.00028
    }},
    {"summary_entry": {
      "description": "sp|Q9CHZ4|Y574_LACLA Probable tautomerase LL0574 OS=Lactococcus lactis s...",
      "score": 34,
      "evalue": 0.00033
    }},
    {"summary_entry": {
      "description": "sp|Q71WL5|Y2536_LISMF Probable tautomerase LMOf2365_2536 OS=Listeria mon...",
      "score": 34,
      "evalue": 0.00055
    }},
    {"summary_entry": {
      "description": "sp|Q93JW0|4OT4_PSEPU 2-hydroxymuconate tautomerase OS=Pseudomonas putida...",
      "score": 34,
      "evalue": 0.00066
    }},
    {"summary_entry": {
      "description": "sp|Q8Y183|Y807_RALSO Probable tautomerase RSc0807 OS=Ralstonia solanacea...",
      "score": 33,
      "evalue": 0.00077
    }},
    {"summary_entry": {
      "description": "sp|Q814P5|Y5378_BACCR Probable tautomerase BC_5378 OS=Bacillus cereus (s...",
      "score": 34,
      "evalue": 0.00089
    }},
    {"summary_entry": {
      "description": "sp|Q9PCQ3|Y1725_XYLFA Probable tautomerase XF_1725 OS=Xylella fastidiosa...",
      "score": 36,
      "evalue": 0.0011
    }},
    {"summary_entry": {
      "description": "sp|Q9RHM8|4OT_COMTE 2-hydroxymuconate tautomerase OS=Comamonas testoster...",
      "score": 33,
      "evalue": 0.0014
    }},
    {"summary_entry": {
      "description": "sp|A7MK78|PPTA_CROS8 Tautomerase PptA OS=Cronobacter sakazakii (strain A...",
      "score": 34,
      "evalue": 0.0037
    }},
    {"summary_entry": {
      "description": "sp|A6T9Q5|PPTA_KLEP7 Tautomerase PptA OS=Klebsiella pneumoniae subsp. pn...",
      "score": 32,
      "evalue": 0.02
    }},
    {"summary_entry": {
      "description": "sp|A4WAM9|PPTA_ENT38 Tautomerase PptA OS=Enterobacter sp. (strain 638) O...",
      "score": 32,
      "evalue": 0.02
    }},
    {"summary_entry": {
      "description": "sp|B1XDG9|PPTA_ECODH Tautomerase PptA OS=Escherichia coli (strain K12 \/...",
      "score": 32,
      "evalue": 0.023
    }},
    {"summary_entry": {
      "description": "sp|C6DH49|PPTA_PECCP Tautomerase PptA OS=Pectobacterium carotovorum subs...",
      "score": 31,
      "evalue": 0.03
    }}
  ],
  "search_hits": [
    {"hit_record": {
      "target_description": "4M1A_A Hypothetical protein; PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, PROTEIN STRUCTURE INITIATIVE, DUF1904, alpha\/beta, trimeric assembly, Structural; HET: MSE; 1.9A {Sebaldella termitidis}",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 126,
      "target_eno": 11.0,
      "alignment": {
        "score": 96.71,
        "bit_score": 114.5,
        "evalue": 5e-25,
        "pvalue": 5e-25,
        "n_identities": 44,
        "n_positives": 61,
        "n_gaps": 1,
        "aln_length": 106,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 106,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee   hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee   hhhhhhhhhhhhhhhhh     eeeeeee           ",
        "target_secstr": "  eeeeee     hhhhhhhhhhhhhhh       eeeeee eeeee       eeeeeeee    hhhhhhhhhhhhhhhhhh   eeeeeeee     eee   ",
        "query_aln": "MPHLRIRGIEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFARDQEVQDLVAQTITNQIRRADYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPHIRVRGAEKEKVRDFTAGLADELGIIAECPADWFTFEYVETTFFFDGKEDDGLVFIEVLWFDRDSEARDKIAALFTERWKKITDKIVTIVFNPLIENMYYEDGV",
        "middle": "MPH+R+RG+E++KV++++++L++EL++I+++P+++FT+E+++++FF+DGK+DD ++F+EVLWF+RD+E++D++A+++T++++++++++V+I+F++L++++YYE+G+",
        "computed_K_ungapped": "0.1570",
        "computed_lambda_ungapped": "1.3958",
        "estimated_K_gapped": "0.0020",
        "estimated_lambda_gapped": "0.7016",
        "entropy": 0.4406,
        "expected_score": -0.2920,
        "min_score": -3,
        "max_score": 4
      }
    }},
    {"hit_record": {
      "target_description": "1U9D_B hypothetical protein VC0714; structural genomics, MCSG, hypothetical protein, protein structure initiative, PSI, Midwest Center for Structural Genomics, UNKNOWN FUNCTION; HET: PO4, MSE; 1.7A {Vibrio cholerae O1 biovar eltor str. N16961} SCOP: l.1.1.1, d.80.1.5",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 122,
      "target_eno": 11.0,
      "alignment": {
        "score": 98.39,
        "bit_score": 114.0,
        "evalue": 7.1e-25,
        "pvalue": 7.1e-25,
        "n_identities": 53,
        "n_positives": 50,
        "n_gaps": 4,
        "aln_length": 107,
        "query_from": 1,
        "query_to": 105,
        "target_from": 16,
        "target_to": 120,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee   hhhhhhh hhhhhhhhhhh     eeeeeee  eeee        eeeeeee   hhhhhhhhhhhhhhhhh       eeeeeee           ",
        "target_secstr": " eeeeee   hhhhhhhhhhhhhhhhhhh      eeeeee  eeee       eeeeeeee     hhhhhhhhhhhhhhhh     eeeeeeee     eee  e",
        "query_aln": "MPHLRIRGIEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDDYPFVEVLWFARDQEVQDLVAQTITNQIRRADYE--SVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPHLRFRAVEAHIVESLVPTLLNELSSLLSTARNAFTFELINTQYFAEGG--VYPMVEVLWFGREQQTQDQIAQVITDQIRQLLGADSHLAVVFIPLQRTAYYLDGQ",
        "middle": "MPHLR+R++E+++V++L+PTL+NEL+++++T+R++FT+ELIN+Q+F++G+  +YP+VEVLWF+R+Q++QD++AQ+IT+QIR+++++  ++A++F++L+++AYY++GQ",
        "computed_K_ungapped": "0.1863",
        "computed_lambda_ungapped": "1.3468",
        "estimated_K_gapped": "0.0024",
        "estimated_lambda_gapped": "0.6770",
        "entropy": 0.4557,
        "expected_score": -0.3210,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q05354|HPCD_ECOLX 5-carboxymethyl-2-hydroxymuconate Delta-isomerase OS=Escherichia coli OX=562 GN=hpcD PE=1 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 126,
      "target_eno": 12.0,
      "alignment": {
        "score": 80.39,
        "bit_score": 93.9,
        "evalue": 7.9e-19,
        "pvalue": 7.9e-19,
        "n_identities": 16,
        "n_positives": 89,
        "n_gaps": 15,
        "aln_length": 120,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 120,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeee   e   h hhhhhh hhhhhhhhhhh     eeeeeee  eeee           eeeeeee    hhhhhhhhhhhhhhhhh            eeeeeee           ",
        "target_secstr": "  eeeeee         hhhhhhhhhhhhhh        eeeeeee  eeee        eeeeeeee     hhhhhhhhhhhhhhhhhhhhhhhh   eeeeeeeee     eee   ",
        "query_aln": "MPHLRI---RGIEE-NKVAELSPTLINELAAIIKTPRESFTIELINSQFFR-DGKI-DD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA-DY------ESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPHFIVECSDNIREEADLPGLFAKVNPTLAATGIFPLAGIRSRVHWVDTWQMADGQHDYASVHMTLKIGAGRSLESRQQAGEMLFELIKTHFAALMESRLLALSFEIEELHPTLNFKQNN",
        "middle": "MPH+++   ++I+E +++++L+++++++LAA++++P+++++++++++++++ ++++ D+ +++++++++A R++E++++++++++++I+++ ++      +++++++++L++++++++++",
        "computed_K_ungapped": "0.1842",
        "computed_lambda_ungapped": "1.4206",
        "estimated_K_gapped": "0.0024",
        "estimated_lambda_gapped": "0.7141",
        "entropy": 0.4744,
        "expected_score": -0.3133,
        "min_score": -3,
        "max_score": 4
      }
    }},
    {"hit_record": {
      "target_description": "4NWP_F Uncharacterized protein; two-component, self-assembling, tetrahedron, designed protein cage, computational design, computational biology, protein engineering, multimerization, nanomaterial, nanostructure, PROTEIN; HET: SO4; 2.1A {Pyrococcus horikoshii}",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 131,
      "target_eno": 12.0,
      "alignment": {
        "score": 78.24,
        "bit_score": 92.4,
        "evalue": 2.3e-18,
        "pvalue": 2.3e-18,
        "n_identities": 19,
        "n_positives": 85,
        "n_gaps": 14,
        "aln_length": 119,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 119,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeee   e    hhhhhhh hhhhhhhhhhh     eeeeeee  eeee           eeeeeee    hhhhhhhhhhhhhhhhh           eeeeeee           ",
        "target_secstr": "  eeeeeee        hhhhhhhhhhhhhhh       eeeeeee  eeee       eeeeeeeeee    hhhhhhhhhhhhhhhhhhh       eeeeeeeeee   eeeee e",
        "query_aln": "MPHLRI---RGIE-ENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKI--DD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA--DYE----SVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPHLVIEATANLRLETSPGELLEQANKALFASGQFGEADIKSRFVTLEAYRQGTAAVERAYLHACLSILDGRDIATRTLLGASLCAVLAEAVAGGGEEGVQVSVEVREMERLSYAKRVV",
        "middle": "MPHL+I   ++++ E++++EL+++++++L+A+++++++++++++++++++R G++  ++ Y+++++++++ RD+++++L+++++++++++A  +++    +V+++++++++++Y+++++",
        "computed_K_ungapped": "0.1661",
        "computed_lambda_ungapped": "1.4562",
        "estimated_K_gapped": "0.0021",
        "estimated_lambda_gapped": "0.7320",
        "entropy": 0.4928,
        "expected_score": -0.3116,
        "min_score": -3,
        "max_score": 4
      }
    }},
    {"hit_record": {
      "target_description": "4DH4_A MIF; Trimer, ISOMERASE; 1.82A {Toxoplasma gondii} SCOP: d.80.1.0",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 114,
      "target_eno": 12.0,
      "alignment": {
        "score": 74.00,
        "bit_score": 90.2,
        "evalue": 1e-17,
        "pvalue": 1e-17,
        "n_identities": 15,
        "n_positives": 86,
        "n_gaps": 8,
        "aln_length": 112,
        "query_from": 2,
        "query_to": 105,
        "target_from": 1,
        "target_to": 112,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "   ee       hhhhhhhhhhhhhhhhhhh      eeeeeee  eee       eeeeeeee     hhhhhhhhhhhhhhhhhhh     eeeeeeee    eeee   ",
        "query_aln": "PHLRIR---GIEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "PKCMIFCPVAATPAQQDALLKDAEKAVADALGKPLSYVMVGYSQTGQMRFGGSSDPCAFIRVASIGGITSSTNCKIAAALSAACERHLGVPKNRIYTTFTNKSPSEWAMGDR",
        "middle": "P+++I+   +++++++++L++++++ +A+++++P++++++++++++ +R G+++D ++F++V++++ +++++++++A++++++++R+   ++++++++FT++++S+++++++",
        "computed_K_ungapped": "0.1996",
        "computed_lambda_ungapped": "1.4510",
        "estimated_K_gapped": "0.0026",
        "estimated_lambda_gapped": "0.7294",
        "entropy": 0.4312,
        "expected_score": -0.2983,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "6VVR_B Tautomerase; symmetric, fused, 4-oxalocrotonate tautomerase, ISOMERASE; 1.8A {Bordetella trematum}",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 123,
      "target_eno": 12.0,
      "alignment": {
        "score": 74.16,
        "bit_score": 88.8,
        "evalue": 2.8e-17,
        "pvalue": 2.8e-17,
        "n_identities": 20,
        "n_positives": 83,
        "n_gaps": 12,
        "aln_length": 116,
        "query_from": 2,
        "query_to": 105,
        "target_from": 1,
        "target_to": 116,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee     eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee            ",
        "target_secstr": " eeeeeee    hhhhhhhhhhhhhhhhhhh      eeeeeee    eeee       eeeeeeee     hhhhhhhhhhhhhhhhhhh      eeeeeee     eee    ",
        "query_aln": "PHLRIR---GIEENKVAELSPTLINELAAIIKTPRESFTIELIN---SQFFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYE-NGQ",
        "target_aln": "PLLNVHIMQGHTPAAKTALLKALSDAVVQSIGAPLASVRAILQEYAAADVIVAGEVGAAMALVNVDLIAGRTVELKAALILALNQAVSASLGMDGKDVRVVLRDIPKTDMGVANGL",
        "middle": "P+L+++   G++++++++L+++L+++++++I++P++S++++L++    +++++G++++ +++V+V+++A R++E++++++++++++++++   D+++V++++++++K+++++ NG+",
        "computed_K_ungapped": "0.1978",
        "computed_lambda_ungapped": "1.4648",
        "estimated_K_gapped": "0.0025",
        "estimated_lambda_gapped": "0.7363",
        "entropy": 0.4471,
        "expected_score": -0.3093,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "1OTG_A 5-CARBOXYMETHYL-2-HYDROXYMUCONATE ISOMERASE; HYDROXYMUCONATE, ISOMERASE; HET: SO4; 2.1A {Escherichia coli} SCOP: d.80.1.2",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 125,
      "target_eno": 11.0,
      "alignment": {
        "score": 74.39,
        "bit_score": 88.0,
        "evalue": 4.9e-17,
        "pvalue": 4.9e-17,
        "n_identities": 15,
        "n_positives": 87,
        "n_gaps": 15,
        "aln_length": 119,
        "query_from": 2,
        "query_to": 105,
        "target_from": 1,
        "target_to": 119,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeee   e    hhhhhhh hhhhhhhhhhh     eeeeeee  e eee          eeeeeee    hhhhhhhhhhhhhhhhh            eeeeeee           ",
        "target_secstr": "  eeeeee        hhhhhhhhhhhhhhh       eeeeeee  eeeee       eeeeeeee     hhhhhhhhhhhhhhhhhhhhhhhh    eeeeeeee           ",
        "query_aln": "PHLRI---RGIE-ENKVAELSPTLINELAAIIKTPRESFTIELINSQ-FFRDGK-IDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA-DY------ESVAIMFTTLTKSAYYENGQ",
        "target_aln": "PHFIVECSDNIREEADLPGLFAKVNPTLAATGIFPLAGIRSRVHWVDTWQMADGQHDYAFVHMTLKIGAGRSLESRQQAGEMLFELIKTHFAALMESRLLALSFEIEELHPTLNFKQNN",
        "middle": "PH+++   ++I+ E+++++L+++++++LAA++++P++++++ +++++ ++++++ +D+ +++++++++A R++E++++++++++++I+++ ++       ++++++++L++++++++++",
        "computed_K_ungapped": "0.1957",
        "computed_lambda_ungapped": "1.4180",
        "estimated_K_gapped": "0.0025",
        "estimated_lambda_gapped": "0.7128",
        "entropy": 0.4405,
        "expected_score": -0.3113,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|P90835|MIF3_CAEEL MIF-like protein mif-3 OS=Caenorhabditis elegans OX=6239 GN=mif-3 PE=3 SV=1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 146,
      "target_eno": 10.0,
      "alignment": {
        "score": 76.06,
        "bit_score": 87.7,
        "evalue": 5.9e-17,
        "pvalue": 5.9e-17,
        "n_identities": 16,
        "n_positives": 82,
        "n_gaps": 5,
        "aln_length": 110,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 110,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee   hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeee      hhhhhhhhhhhhhhh      eeeeee             eeeeeeee        hhhhhhhhhhhhhhhh      eeeeeee     eee   ",
        "query_aln": "MPHLRIRGIEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPVIKVQTNVKKVSDGFEVRLAIHMAKVMKRPESQIFVSLDMNSRMTRGQLTDPLAVLDVTSSTVLTPILTEEYTVALCEFFSQELALDSDAVLINYRSLSPELIGFNGH",
        "middle": "MP+++++  ++ + ++++++L++++A+++K+P+++++++L++++ ++ G+++D +++++V++++ ++++++++++++++++++++   D+++V+I++++L++++++ NG+",
        "computed_K_ungapped": "0.1797",
        "computed_lambda_ungapped": "1.3967",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7021",
        "entropy": 0.4517,
        "expected_score": -0.2998,
        "min_score": -3,
        "max_score": 4
      }
    }},
    {"hit_record": {
      "target_description": "sp|P81529|MIFH_TRISP Macrophage migration inhibitory factor homolog OS=Trichinella spiralis OX=6334 PE=1 SV=2",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 114,
      "target_eno": 12.0,
      "alignment": {
        "score": 73.35,
        "bit_score": 87.7,
        "evalue": 5.9e-17,
        "pvalue": 5.9e-17,
        "n_identities": 12,
        "n_positives": 88,
        "n_gaps": 9,
        "aln_length": 113,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 112,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeee         hhhhhhhhhhhhhh      eeeeeee             eeeeeeeee      hhhhhhhhhhhhhhhhh      eeeeeee    eeee  e",
        "query_aln": "MPHLRIRG---IEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA-D--YESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPIFTLNTNIKATDV-PSDFLSSTSALVGNILSKPGSYVAVHINTDQQLSFGGSTKPAAFGTLMSIGGIEPSRNRDHSAKLFDHLNKKLGIPKNRMYIHFVNLNGDDVGWNGT",
        "middle": "MP+++++    ++++ ++++++++++++++I+++P+++++++++++Q ++ G++++ ++F+++++++ ++++++++++++++++++++ +   ++++I+F++L+++++++NG+",
        "computed_K_ungapped": "0.1759",
        "computed_lambda_ungapped": "1.4105",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7090",
        "entropy": 0.4601,
        "expected_score": -0.3060,
        "min_score": -3,
        "max_score": 4
      }
    }},
    {"hit_record": {
      "target_description": "7YXV_A Anthranilate synthase; cytosolic protein, tautomerase superfamily, 4-oxalocrotonate tautomerase, T6SS; 1.7A {Acinetobacter baumannii}",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 129,
      "target_eno": 12.0,
      "alignment": {
        "score": 73.81,
        "bit_score": 87.7,
        "evalue": 6.1e-17,
        "pvalue": 6.1e-17,
        "n_identities": 21,
        "n_positives": 80,
        "n_gaps": 11,
        "aln_length": 116,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 116,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee     eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeee   hhhhhhhhhhhhhhhhhhhhh       eeeeee               eeeeeeee     hhhhhhhhhhhhhhhhhhh     eeeeeee      eee   ",
        "query_aln": "MPHLRIR---GIEENKVAELSPTLINELAAIIKTPRESFTIELIN---SQFFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MSQVKIYANERTIIQYRELLSHAIHQALIEELKYPVEKRFQRFISLKPENFIYPSDRSQHYIIIELSMFAGRSPATKKQLIQTLFRNIEEQCKIAPQDIEITIFETPKENWGIRGK",
        "middle": "M++++I+   +++++++++LS++++++L++++K+P+E++++ +I+     F++++++++ Y+++E+++FA R+++++++++QT++++I+++   ++++++I++++++K++++ +G+",
        "computed_K_ungapped": "0.1837",
        "computed_lambda_ungapped": "1.4656",
        "estimated_K_gapped": "0.0024",
        "estimated_lambda_gapped": "0.7367",
        "entropy": 0.4389,
        "expected_score": -0.2859,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q02960|MIF_CHICK Macrophage migration inhibitory factor OS=Gallus gallus OX=9031 GN=MIF PE=3 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 115,
      "target_eno": 12.0,
      "alignment": {
        "score": 71.93,
        "bit_score": 87.6,
        "evalue": 6.6e-17,
        "pvalue": 6.6e-17,
        "n_identities": 16,
        "n_positives": 86,
        "n_gaps": 7,
        "aln_length": 112,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 112,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee     hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeee         hhhhhhhhhhhhhh      eeeeee               eeeeeeee    hhhhhhhhhhhhhhhhhhh      eeeeeeee    eee  e",
        "query_aln": "MPHLRIRGIE--ENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPMFTIHTNVCKDAVPDSLLGELTQQLAKATGKPAQYIAVHIVPDQMMSFGGSTDPCALCSLYSIGKIGGQQNKTYTKLLCDMIAKHLHVSADRVYINYFDINAANVGWNGS",
        "middle": "MP+++I++ +  ++++++L+++L+++LA+++++P+++++++++++Q ++ G+++D ++++++++++ ++++++++++++++++I+++   ++++V+I++++++++++++NG+",
        "computed_K_ungapped": "0.1787",
        "computed_lambda_ungapped": "1.5354",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7718",
        "entropy": 0.5226,
        "expected_score": -0.3007,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "3T5S_A Macrophage migration inhibitory factor; SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, IMMUNE SYSTEM; 2.3A {Giardia lamblia} SCOP: d.80.1.0, l.1.1.1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 135,
      "target_eno": 11.0,
      "alignment": {
        "score": 73.43,
        "bit_score": 87.2,
        "evalue": 8.5e-17,
        "pvalue": 8.5e-17,
        "n_identities": 17,
        "n_positives": 87,
        "n_gaps": 7,
        "aln_length": 112,
        "query_from": 1,
        "query_to": 105,
        "target_from": 22,
        "target_to": 133,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  eeee        eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeee       hhhhhhhhhhhhhhhhhhh     eeeeeeee           eeeeeeeeee     hhhhhhhhhhhhhhhh      eeeeeeee    eeee   ",
        "query_aln": "MPHLRIR---GIEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDDYPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPCAIVTTNADFTKDQADAFCLDMGQVLAKETGKPVSYCMAGVRKADMSFGTSTDLCCFVDFYCIGVISQAKNPSISAAITGCLTQHFKVKPERVYISFNEAKGHNWGFNGS",
        "middle": "MP+++++   +++++++++++++++++LA+++++P++++++++++++++++++ D+++FV++++++ ++Q+++++++++IT++++++   ++E+V+I+F++++++++++NG+",
        "computed_K_ungapped": "0.1646",
        "computed_lambda_ungapped": "1.4662",
        "estimated_K_gapped": "0.0021",
        "estimated_lambda_gapped": "0.7370",
        "entropy": 0.4782,
        "expected_score": -0.2876,
        "min_score": -3,
        "max_score": 4
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q76BK2|MIF_XENLA Macrophage migration inhibitory factor OS=Xenopus laevis OX=8355 GN=mif PE=1 SV=1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 115,
      "target_eno": 12.0,
      "alignment": {
        "score": 71.41,
        "bit_score": 87.0,
        "evalue": 9.9e-17,
        "pvalue": 9.9e-17,
        "n_identities": 19,
        "n_positives": 81,
        "n_gaps": 9,
        "aln_length": 113,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 112,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeee         hhhhhhhhhhhhhh      eeeeee     ee        eeeeeeee     hhhhhhhhhhhhhhhhh       eeeeeee     eeee e",
        "query_aln": "MPHLRIR---GIEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPVFTIRTNVCRDSV-PDTLLSDLTKQLAKATGKPAEYIAIHIVPDQIMSFGDSTDPCAVCSLCSIGKIGGPQNKSYTKLLCDILTKQLNIPANRVYINYYDLNAANVGWNGS",
        "middle": "MP+++IR   +++++ +++L+++L++ LA+++++P+E+++I+++++Q+++ G+++D ++++++++++ ++++++++++++++++++++   + ++V+I++++L++++++ NG+",
        "computed_K_ungapped": "0.1806",
        "computed_lambda_ungapped": "1.4688",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7383",
        "entropy": 0.4712,
        "expected_score": -0.3002,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "3E6Q_C putative 5-carboxymethyl-2-hydroxymuconate isomerase; structural genomics, APC7683, isomerase, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG; HET: FMT, GOL, IMD, EDO, MSE; 1.75A {Pseudomonas aeruginosa}",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 146,
      "target_eno": 11.0,
      "alignment": {
        "score": 75.82,
        "bit_score": 86.6,
        "evalue": 1.3e-16,
        "pvalue": 1.3e-16,
        "n_identities": 19,
        "n_positives": 83,
        "n_gaps": 14,
        "aln_length": 119,
        "query_from": 1,
        "query_to": 105,
        "target_from": 22,
        "target_to": 140,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeee   e    hhhhhhh hhhhhhhhhhh     eeeeeee  eeee           eeeeeee    hhhhhhhhhhhhhhhhh           eeeeeee           ",
        "target_secstr": "  eeeeee         hhhhhhhhhhhhhhh       eeeeeee  eeee       eeeeeeeee     hhhhhhhhhhhhhhhhhh        eeeeeeeeee    eee   ",
        "query_aln": "MPHLRI---RGIE-ENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKI--DD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA-D--YE---SVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPHLVIEATANLRLETSPGELLEQANAALFASGQFGEADIKSRFVTLEAYRQGTAAVERAYLHACLSILDGRDAATRQALGESLCEVLAGAVAGGGEEGVQVSVEVREMERASYAKRVV",
        "middle": "MPHL+I    +++ E++++EL+++++++L+A+++++++++++++++++ +R G++  ++ Y+++++++++ RD+++++++++++++++++A +  +E   +V+++++++++++Y+++++",
        "computed_K_ungapped": "0.1612",
        "computed_lambda_ungapped": "1.4398",
        "estimated_K_gapped": "0.0021",
        "estimated_lambda_gapped": "0.7237",
        "entropy": 0.4579,
        "expected_score": -0.2945,
        "min_score": -3,
        "max_score": 4
      }
    }},
    {"hit_record": {
      "target_description": "sp|O34882|YOLI_BACSU Probable tautomerase YolI OS=Bacillus subtilis (strain 168) OX=224308 GN=yolI PE=3 SV=1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 129,
      "target_eno": 12.0,
      "alignment": {
        "score": 73.11,
        "bit_score": 86.4,
        "evalue": 1.4e-16,
        "pvalue": 1.4e-16,
        "n_identities": 12,
        "n_positives": 89,
        "n_gaps": 15,
        "aln_length": 120,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 120,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeee   e   hhhhhhh hhhhhhhhhhh     eeeeeee     eeee              eeeeeee   hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeee     hhhhhhhhhhhhhhhhhh        eeeeee     ee             eeeeeeee    hhhhhhhhhhhhhhhhhhh      eeeeeee           ",
        "query_aln": "MPHLRI---RGIEENKVAELSPTLINELAAIIKTPRESFTIELIN---SQFFRDG-----KIDD-YPFVEVLWFARDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPLLRFDVIEGRDEKSLQLLLDTAHQAMVEAFGVPERDRYQIVHQHPANELIIQDAGLGFQRTKDMVIISMTSKARTESQKEKLYALLAERLEKKCEISPDDLMVSITENGDADWSFGLG",
        "middle": "MP+LR+   +G++E+++++L++T+++++++++++P++++++ +++    ++++++     ++++ ++++++++ AR+++++++++++++++++++   +++++++++T++++++++ +++",
        "computed_K_ungapped": "0.1848",
        "computed_lambda_ungapped": "1.4905",
        "estimated_K_gapped": "0.0024",
        "estimated_lambda_gapped": "0.7492",
        "entropy": 0.4768,
        "expected_score": -0.2963,
        "min_score": -3,
        "max_score": 4
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q640C5|DOPDB_XENLA D-dopachrome decarboxylase-B OS=Xenopus laevis OX=8355 GN=ddt-b PE=3 SV=1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 118,
      "target_eno": 12.0,
      "alignment": {
        "score": 71.45,
        "bit_score": 86.3,
        "evalue": 1.6e-16,
        "pvalue": 1.6e-16,
        "n_identities": 16,
        "n_positives": 84,
        "n_gaps": 10,
        "aln_length": 114,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 113,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee     hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeee        hhhhhhhhhhhhhhhh     eeeeeeee eeeee       eeeeeeee     hhhhhhhhhhhhhhhhhhh      eeeeeee          e",
        "query_aln": "MPHLRIRG---IEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFAR--DQEVQDLVAQTITNQIRRA-D--YESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPFVELDTNLQQQ-EVPQDLAEKLCSATATILGKPRERVNVTVRTGVSMVVGGSSAPCTQLIISSIGVVGTAEQNKEHSAKFFNFLTEQLGLAQDRILLRFVPLEPWQIGKNGT",
        "middle": "MP+++++    ++ +++++L+++L++++A+I+++PRE++++++++++ ++ G++++ +++++++++++  ++E++++++++++N+++++ +  +++++++F++L++++++ NG+",
        "computed_K_ungapped": "0.1810",
        "computed_lambda_ungapped": "1.4643",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7361",
        "entropy": 0.4704,
        "expected_score": -0.2996,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "1UIZ_B Macrophage Migration Inhibitory Factor; Cytokine, Tautomerase, Macrophage Migration Inhibitory Factor, MIF; 2.5A {Xenopus laevis} SCOP: d.80.1.3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 115,
      "target_eno": 12.0,
      "alignment": {
        "score": 70.85,
        "bit_score": 86.3,
        "evalue": 1.6e-16,
        "pvalue": 1.6e-16,
        "n_identities": 19,
        "n_positives": 82,
        "n_gaps": 9,
        "aln_length": 113,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 112,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeee        hhhhhhhhhhhhhhhh     eeeeee               eeeeeeeee    hhhhhhhhhhhhhhhhh       eeeeeee    eeee  e",
        "query_aln": "MPHLRIR---GIEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPVFTIRTNVCRDS-VPDTLLSDLTKQLAKATGKPAEYIAIHIVPDQIMSFGDSTDPCAVCSLCSIGKIGGPQNKSYTKLLCDILTKQLNIPANRVYINYYDLNAANVGWNGS",
        "middle": "MP+++IR   ++++ ++++L+++L+++LA+++++P+E+++I++ ++Q+++ G+++D ++++++++++ ++++++++++++++++++++   + ++V+I++++L+++++++NG+",
        "computed_K_ungapped": "0.1787",
        "computed_lambda_ungapped": "1.5063",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7572",
        "entropy": 0.4966,
        "expected_score": -0.2988,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "5UNQ_B Putative tautomerase; 4-Oxalocrotonate tautomerase, MIF, cisCaaD, dehalogenase, hydrolase; HET: DYJ; 1.976A {Pusillimonas sp. (strain T7-7)}",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 123,
      "target_eno": 12.0,
      "alignment": {
        "score": 72.08,
        "bit_score": 86.2,
        "evalue": 1.7e-16,
        "pvalue": 1.7e-16,
        "n_identities": 15,
        "n_positives": 88,
        "n_gaps": 12,
        "aln_length": 116,
        "query_from": 2,
        "query_to": 105,
        "target_from": 1,
        "target_to": 116,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeee   e   hhhhhhh hhhhhhhhhhh     eeeeeee     eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee            ",
        "target_secstr": "  eeeee     hhhhhhhhhhhhhhhhhhh      eeeeeee               eeeeeeeee    hhhhhhhhhhhhhhhhhh      eeeeeeee     eee    ",
        "query_aln": "PHLRI---RGIEENKVAELSPTLINELAAIIKTPRESFTIELIN---SQFFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA-D--YESVAIMFTTLTKSAYYE-NGQ",
        "target_aln": "XYVTISATEGLSAEKKKQLLERSSDAVVQSIGAPLASVRVMLHELPGGHYLNAGQFNTPGLMFVVDFIEGRTEEQRNALIAALSKTGTETTGIPESEVRVRLLDFPKANMGMAGGI",
        "middle": "++++I   +G++++K+++L+++++++++++I++P++S++++L++   ++++++G++++ +++++V++++ R++E++++++++++++++++ +  +++V++++++++K++++  +G+",
        "computed_K_ungapped": "0.1993",
        "computed_lambda_ungapped": "1.5107",
        "estimated_K_gapped": "0.0026",
        "estimated_lambda_gapped": "0.7594",
        "entropy": 0.4456,
        "expected_score": -0.2969,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|P81748|MIFH_TRITR Macrophage migration inhibitory factor homolog OS=Trichuris trichiura OX=36087 PE=1 SV=2",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 114,
      "target_eno": 13.0,
      "alignment": {
        "score": 72.81,
        "bit_score": 85.8,
        "evalue": 2.3e-16,
        "pvalue": 2.3e-16,
        "n_identities": 16,
        "n_positives": 82,
        "n_gaps": 9,
        "aln_length": 113,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 112,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeee        hhhhhhhhhhhhhhh      eeeeeee    ee        eeeeeee     hhhhhhhhhhhhhhhhh       eeeeeeee     ee   e",
        "query_aln": "MPHLRIRG---IEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPIFTFSTNVPSENI-SVDFLKSTSKLIAGMLGKPESYVAVHINGGQKITFGGTDAPAGFGQLLSLGGVGGEKNRSHSAKLFKHLTDGLGIPGNRMYINFVDMRGSDVGYNGS",
        "middle": "MP++++++   +E++  +++++++++++A+++++P++++++++++ Q ++ G++D+ ++F+++L+++ +++E++++++++++++++++   + ++++I+F+++++S+++ NG+",
        "computed_K_ungapped": "0.1659",
        "computed_lambda_ungapped": "1.4474",
        "estimated_K_gapped": "0.0021",
        "estimated_lambda_gapped": "0.7276",
        "entropy": 0.4668,
        "expected_score": -0.2916,
        "min_score": -3,
        "max_score": 4
      }
    }},
    {"hit_record": {
      "target_description": "4LKB_D hypothetical protein alr4568\/putative 4-Oxalocrotonate Tautomerase; PSI-BIOLOGY, STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI Biology, New York Structural Genomics Research Consortium, NYSGRC, 026795; HET: MSE, GOL, SO4; 2.16A {Nostoc sp. PCC 7120} SCOP: l.1.1.1, d.80.1.0",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 151,
      "target_eno": 12.0,
      "alignment": {
        "score": 74.68,
        "bit_score": 85.5,
        "evalue": 2.7e-16,
        "pvalue": 2.7e-16,
        "n_identities": 19,
        "n_positives": 84,
        "n_gaps": 11,
        "aln_length": 116,
        "query_from": 1,
        "query_to": 105,
        "target_from": 23,
        "target_to": 138,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee     eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeee      hhhhhhhhhhhhhhhhh       eeeeeee    eeee        eeeeeeee    hhhhhhhhhhhhhhhhhh      eeeeeeee     eeee  ",
        "query_aln": "MPHLRIR---GIEENKVAELSPTLINELAAIIKTPRESFTIELIN---SQFFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MVQIKVYGLAEKLNPIKAELSNILHTSLIEVLQISPEKRFHRFFPLDKLDFYYPSDRTDNYLIIEIIMFEGRSVETKKQLLRDIFKKVDEKFGISVYDIEITLFEIPKQNWGIRGI",
        "middle": "M++++++   +++++++AELS++L+++L++++++++E++++ +++    +F+++++++D Y+++E+++F+ R++E++++++++I+++++++   ++++++I++++++K++++++G+",
        "computed_K_ungapped": "0.1712",
        "computed_lambda_ungapped": "1.4773",
        "estimated_K_gapped": "0.0022",
        "estimated_lambda_gapped": "0.7426",
        "entropy": 0.4453,
        "expected_score": -0.2828,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "5UIF_A Ps01740; 4-oxalocrotonate-Tautomerase, MIF, cis-Caad, dehalogenase, HYDROLASE; 2.57A {Pseudomonas sp. UW4}",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 127,
      "target_eno": 12.0,
      "alignment": {
        "score": 73.29,
        "bit_score": 85.5,
        "evalue": 2.7e-16,
        "pvalue": 2.7e-16,
        "n_identities": 17,
        "n_positives": 86,
        "n_gaps": 11,
        "aln_length": 115,
        "query_from": 2,
        "query_to": 105,
        "target_from": 1,
        "target_to": 115,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeeee       hhhhhhh hhhhhhhhhhh     eeeeeee     eeee        eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": " eeeeee      hhhhhhhhhhhhhhhhhh       eeeeeee               eeeeeeee    hhhhhhhhhhhhhhhhhhh     eeeeeeee     eee  e",
        "query_aln": "PHLRIRG----IEENKVAELSPTLINELAAIIKTPRESFTIELINS---QFFRDGKIDDYPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "PLYECQTVKGTLSERQRQSLAESITSIHTRETGAPASYVHVLFKELEPGSAFTAGQVATPAIIRGQIRAGRPQATRHAILRAITDVYMAVTGADANAVVVAVVDIPASWAMEGGQ",
        "middle": "P+++++     ++E+++++L++++++++++++++P+++++++++++   ++F++G+++++++++++++A R+Q+++++++++IT++++++   D+++V+++++++++S+++E+GQ",
        "computed_K_ungapped": "0.1926",
        "computed_lambda_ungapped": "1.4257",
        "estimated_K_gapped": "0.0025",
        "estimated_lambda_gapped": "0.7167",
        "entropy": 0.4362,
        "expected_score": -0.2995,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "4JCU_B 5-carboxymethyl-2-hydroxymuconate isomerase; Structural Genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, alpha\/beta, Triangular trimer assembly, PROTEIN STRUCTURE; HET: MSE; 2.4A {Deinococcus radiodurans} SCOP: d.80.1.0, l.1.1.1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 150,
      "target_eno": 11.0,
      "alignment": {
        "score": 75.05,
        "bit_score": 85.2,
        "evalue": 3.4e-16,
        "pvalue": 3.4e-16,
        "n_identities": 17,
        "n_positives": 84,
        "n_gaps": 17,
        "aln_length": 121,
        "query_from": 1,
        "query_to": 104,
        "target_from": 23,
        "target_to": 143,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeee   e   hhhhhhh hhhhhhhhhh h     eeeeeee  eeee            eeeeeee    hhhhhhhhhhhhhhhhh            eeeeeee           ",
        "target_secstr": "  eeeeeee       hhhhhhhhhhhhhh         eeeeee    ee          eeeeeeee     hhhhhhhhhhhhhhhhhh         eeeeeeeee           ",
        "query_aln": "MPHLRI---RGIEENKVAELSPTLINELAAI-IKTPRESFTIELINSQFFRDGK-I--DD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA-D-YE-----SVAIMFTTLTKS-AYYENG",
        "target_aln": "MPHLTLEYTDNLPEPRIPELLQKLNGVLLARPDIFPVGGIRARAYRLSEYALADSSEPSDAFVHLRLQIGAGRSEEVKKETGDALFAVLTDHFAAEFAQRGLMLSAEISEFSEAGTWKKNN",
        "middle": "MPHL++   ++++E++++EL+++L+++L+A+ +++P++++++++++ + ++ ++ +  +D +++++++++A R++EV+++++++++++++++ + ++     ++++++++++++ ++++N+",
        "computed_K_ungapped": "0.1793",
        "computed_lambda_ungapped": "1.4233",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7154",
        "entropy": 0.4378,
        "expected_score": -0.2957,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|P30046|DOPD_HUMAN D-dopachrome decarboxylase OS=Homo sapiens OX=9606 GN=DDT PE=1 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 118,
      "target_eno": 12.0,
      "alignment": {
        "score": 70.49,
        "bit_score": 85.0,
        "evalue": 3.8e-16,
        "pvalue": 3.8e-16,
        "n_identities": 14,
        "n_positives": 86,
        "n_gaps": 10,
        "aln_length": 114,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 113,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee     hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeee           hhhhhhhhhhhhhh     eeeeeee    eee      eeeeeeeee     hhhhhhhhhhhhhhhhhhh     eeeeeeee    eeee  e",
        "query_aln": "MPHLRIR---GIEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFAR--DQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPFLELDTNLPANRVP-AGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGT",
        "middle": "MP+L+++   ++++++ A+L+++L++ +A+I+++P+++++++++++ +++ +++++ +++++++++++  ++E++++++++++++++++   ++++++I+F++L++++++ +G+",
        "computed_K_ungapped": "0.1806",
        "computed_lambda_ungapped": "1.5247",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7665",
        "entropy": 0.4934,
        "expected_score": -0.2986,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "6VVN_B 4-oxalocrotonate tautomerase; asymmetric, fused, 4-oxalocrotonate tautomerase, ISOMERASE; HET: GOL; 1.39A {Caballeronia arationis} SCOP: d.80.1.0",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 123,
      "target_eno": 12.0,
      "alignment": {
        "score": 72.35,
        "bit_score": 84.9,
        "evalue": 4.1e-16,
        "pvalue": 4.1e-16,
        "n_identities": 21,
        "n_positives": 80,
        "n_gaps": 12,
        "aln_length": 116,
        "query_from": 2,
        "query_to": 105,
        "target_from": 1,
        "target_to": 116,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee     eeee          eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": " eeeeee     hhhhhhhhhhhhhhhhhh       eeeeeee     ee           eeeeeee    hhhhhhhhhhhhhhhhhhh     eeeeeeee     eee  e",
        "query_aln": "PHLRIR---GIEENKVAELSPTLINELAAIIKTPRESFTIELI--N-SQFFRDGKIDD--YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "PTLEVYLPQGHAVERKASLIQGLTQATVDAIGAPAESVRILLSELPATNIGLGGTLTPSALPVIIAILIAGRTDAQKKALIAQLSETIAAVLDAPLQSTRVMIKDIPNTDFGIGGQ",
        "middle": "P+L+++   G++++++A+L+++L+++++++I++P+ES++I+L+  +  +++++G+ ++  +P+++++++A R+++++++++++++++I+++   + +S+++M++++++++++++GQ",
        "computed_K_ungapped": "0.1871",
        "computed_lambda_ungapped": "1.4136",
        "estimated_K_gapped": "0.0024",
        "estimated_lambda_gapped": "0.7106",
        "entropy": 0.4262,
        "expected_score": -0.3060,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q28J83|DOPD_XENTR D-dopachrome decarboxylase OS=Xenopus tropicalis OX=8364 GN=ddt PE=3 SV=1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 118,
      "target_eno": 12.0,
      "alignment": {
        "score": 70.27,
        "bit_score": 84.8,
        "evalue": 4.5e-16,
        "pvalue": 4.5e-16,
        "n_identities": 14,
        "n_positives": 84,
        "n_gaps": 10,
        "aln_length": 114,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 113,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee     hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "   eeee         hhhhhhhhhhhhhhh      eeeeeee    eee      eeeeeeeee      hhhhhhhhhhhhhhhhh       eeeeeee     eee  e",
        "query_aln": "MPHLRIRG---IEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFAR--DQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPFVELDTNLPPQ-QVPQDLAEKLCSATATILSKPRERVNVTVRTGVSMVVGGSCAPCTQLLVSSIGVVGTAEQNKEHSAKFFQFLTENMGLEQDRILLRFVPLEPWQVGKKAT",
        "middle": "MP+++++    ++ +++++L+++L++ +A+I+++PRE++++++++++ ++ G++++ +++++V+++++  ++E++++++++++++++++   + ++++++F++L++++++ +++",
        "computed_K_ungapped": "0.1836",
        "computed_lambda_ungapped": "1.4840",
        "estimated_K_gapped": "0.0024",
        "estimated_lambda_gapped": "0.7460",
        "entropy": 0.4723,
        "expected_score": -0.2953,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|O32183|YUSQ_BACSU Probable tautomerase YusQ OS=Bacillus subtilis (strain 168) OX=224308 GN=yusQ PE=3 SV=1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 127,
      "target_eno": 12.0,
      "alignment": {
        "score": 71.17,
        "bit_score": 84.7,
        "evalue": 4.6e-16,
        "pvalue": 4.6e-16,
        "n_identities": 22,
        "n_positives": 80,
        "n_gaps": 16,
        "aln_length": 121,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 121,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeee   e   hhhhhhh hhhhhhhhhhh     eeeeeee     eeee              eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhhhh      eeeeeee    eee             eeeeeeeee    hhhhhhhhhhhhhhhhhh       eeeeeee           ",
        "query_aln": "MPHLRI---RGIEENKVAELSPTLINELAAIIKTPRESFTIELINS---QFFRDG-----KIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPFVQIHLRSGRSEVWLQKLSRTIHQSMIEEINVPEDDYFQVIRQYEKSEFFYDPFYLQVERTDELIYIHFTLKQSRTTEQKKALYRSIASRIHSELGVRKEDVFIMLAGNQDEDWSFGNG",
        "middle": "MP+++I   +G++E+++++LS+T++++++++I++P+++++++++++    FF+D+     +++D ++++++++++ R++E++++++++I+++I+++   + E+V+IM++++++++++ +++",
        "computed_K_ungapped": "0.1805",
        "computed_lambda_ungapped": "1.4945",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7512",
        "entropy": 0.4753,
        "expected_score": -0.2970,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "6B1K_B Macrophage migration inhibitory factor; CD74 BINDING, TAUTOMERASE, INHIBITOR, COMPLEX, ISOMERASE-ISOMERASE INHIBITOR COMPLEX, ISOMERASE; HET: SO4, C9G; 1.17A {Homo sapiens} SCOP: d.80.1.3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 114,
      "target_eno": 12.0,
      "alignment": {
        "score": 69.56,
        "bit_score": 84.7,
        "evalue": 4.7e-16,
        "pvalue": 4.7e-16,
        "n_identities": 10,
        "n_positives": 91,
        "n_gaps": 7,
        "aln_length": 111,
        "query_from": 2,
        "query_to": 105,
        "target_from": 1,
        "target_to": 111,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeeee     hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": " eeeee         hhhhhhhhhhhhhh      eeeeeee   eeee      eeeeeeeee    hhhhhhhhhhhhhhhhhhh      eeeeeeee    eeee e",
        "query_aln": "PHLRIRGIE--ENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNS",
        "middle": "P+++++  +  ++++++++++L+++LA+++++P+++++++++++Q+++ G++++ ++++++++++ ++++++++++++++++++++   ++++V+I++++++++++++N++",
        "computed_K_ungapped": "0.1939",
        "computed_lambda_ungapped": "1.5106",
        "estimated_K_gapped": "0.0025",
        "estimated_lambda_gapped": "0.7594",
        "entropy": 0.4432,
        "expected_score": -0.2917,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|A9JSE7|MIF_XENTR Macrophage migration inhibitory factor OS=Xenopus tropicalis OX=8364 GN=mif PE=3 SV=1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 115,
      "target_eno": 12.0,
      "alignment": {
        "score": 69.75,
        "bit_score": 84.7,
        "evalue": 4.9e-16,
        "pvalue": 4.9e-16,
        "n_identities": 18,
        "n_positives": 81,
        "n_gaps": 9,
        "aln_length": 113,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 112,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeee         hhhhhhhhhhhhhh      eeeeee     ee         eeeeeeee       hhhhhhhhhhhhhh       eeeeeee           ",
        "query_aln": "MPHLRIRG---IEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPTFTVCTNVCRDS-MPDTLLSDLTKLLAKATGKPAEYIAIHIMPDQMMSFGDSTDPCAVCSLSSIGKIGGPQNKSYSKLLCDYLTKQMNIPANRVYINFHDLNPANVGWNGS",
        "middle": "MP++++++   +++ + ++L+++L+++LA+++++P+E+++I++++ Q+++ G++ D ++++++++++ ++++++++++++++++++++   + ++V+I+F++L+++++++NG+",
        "computed_K_ungapped": "0.1680",
        "computed_lambda_ungapped": "1.4703",
        "estimated_K_gapped": "0.0022",
        "estimated_lambda_gapped": "0.7391",
        "entropy": 0.4605,
        "expected_score": -0.2874,
        "min_score": -3,
        "max_score": 4
      }
    }},
    {"hit_record": {
      "target_description": "2XCZ_A POSSIBLE ATLS1-LIKE LIGHT-INDUCIBLE PROTEIN; CYTOKINE, TAUTOMERASE, IMMUNE SYSTEM, CYANOBACTERIUM; 1.64A {PROCHLOROCOCCUS MARINUS} SCOP: d.80.1.0",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 115,
      "target_eno": 12.0,
      "alignment": {
        "score": 69.80,
        "bit_score": 84.6,
        "evalue": 5.1e-16,
        "pvalue": 5.1e-16,
        "n_identities": 20,
        "n_positives": 77,
        "n_gaps": 7,
        "aln_length": 112,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 112,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee     hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeee     hhhhhhhhhhhhhhhhhh     eeeeeee             eeeeeeee      hhhhhhhhhhhhhhhhh       eeeeeee    eeee   ",
        "query_aln": "MPHLRIRGI--EENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRD-GKIDDYPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPLINIQASVPAVADANSLLQELSSKLAELLGKPEKYVMTSLQCGVPMTFSGNTEPTCYVEVKSIGALDGSRTQEVSELVCGHIEQNLGIPADRIYIGFEDVPARLWGWNGS",
        "middle": "MP+++I+    +++++++L+++L+++LA+++++P+++++++L++++ +   G+++++++VEV++ + +D++++++V+++++++I+++   + ++++I+F+++++++++ NG+",
        "computed_K_ungapped": "0.1787",
        "computed_lambda_ungapped": "1.5203",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7642",
        "entropy": 0.4860,
        "expected_score": -0.2890,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q18785|MIF2_CAEEL MIF-like protein mif-2 OS=Caenorhabditis elegans OX=6239 GN=mif-2 PE=3 SV=1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 120,
      "target_eno": 12.0,
      "alignment": {
        "score": 71.18,
        "bit_score": 84.0,
        "evalue": 8e-16,
        "pvalue": 8e-16,
        "n_identities": 22,
        "n_positives": 79,
        "n_gaps": 9,
        "aln_length": 113,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 112,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeee          hhhhhhhhhhhhh       eeeeeee   eeee      eeeeeee     hhhhhhhhhhhhhhhhhhh      eeeeeee     eee   ",
        "query_aln": "MPHLRIR---GIEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA-D--YESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPMVRVATNLPNEKV-PVDFEIRLTDLLARSMGKPRERIAVEIAAGARLVHGATHDPVTVISIKSIGAVSAEDNIRNTAAITEFCGKELGLPKDKVVITFHDLPPATVGFNGT",
        "middle": "MP++R++   ++E++  ++++++L+++LA+++++PRE++++E+++ ++++ G+++D ++++++++++ +++E++++++++IT++++++ +  +++V+I+F++L+++++++NG+",
        "computed_K_ungapped": "0.1763",
        "computed_lambda_ungapped": "1.4415",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7246",
        "entropy": 0.4542,
        "expected_score": -0.2931,
        "min_score": -3,
        "max_score": 4
      }
    }},
    {"hit_record": {
      "target_description": "sp|O55052|MIF_MERUN Macrophage migration inhibitory factor OS=Meriones unguiculatus OX=10047 GN=MIF PE=3 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 115,
      "target_eno": 12.0,
      "alignment": {
        "score": 68.79,
        "bit_score": 83.8,
        "evalue": 9.1e-16,
        "pvalue": 9.1e-16,
        "n_identities": 12,
        "n_positives": 89,
        "n_gaps": 9,
        "aln_length": 113,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 112,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeee        hhhhhhhhhhhhhhhh    eeeeeeee              eeeeeeee     hhhhhhhhhhhhhhhhhhh     eeeeeee     eee  e",
        "query_aln": "MPHLRIRG---IEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPMFIVNTNVPRSSV-PEGLLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGSSDPCALCSLHSIGKIGGAQNRTYSKLLCGLLADRLRISPDRIYINYYDMNAANVGWNGS",
        "middle": "MP+++++    ++++ +++L+++L+++LA+++++P+++++++++++Q ++ ++++D ++++++++++ ++++++++++++++++++++   ++++++I++++++++++++NG+",
        "computed_K_ungapped": "0.1690",
        "computed_lambda_ungapped": "1.5235",
        "estimated_K_gapped": "0.0022",
        "estimated_lambda_gapped": "0.7658",
        "entropy": 0.5048,
        "expected_score": -0.2905,
        "min_score": -3,
        "max_score": 4
      }
    }},
    {"hit_record": {
      "target_description": "2OS5_D AceMIF; macrophage migration inhibitory factor, cytokine, nematode, hookworm; HET: SO4; 1.6A {Ancylostoma ceylanicum} SCOP: d.80.1.0",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 119,
      "target_eno": 12.0,
      "alignment": {
        "score": 69.51,
        "bit_score": 83.8,
        "evalue": 9.2e-16,
        "pvalue": 9.2e-16,
        "n_identities": 21,
        "n_positives": 81,
        "n_gaps": 9,
        "aln_length": 113,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 112,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  ee ee        eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeee         hhhhhhhhhhhhhh       eeeeeee  ee        eeeeeeeee     hhhhhhhhhhhhhhhh       eeeeeeee    eeee  e",
        "query_aln": "MPHLRIR---GIEENKVAELSPTLINELAAIIKTPRESFTIELINSQF-FRDGKIDDYPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPMVRVATNLP-DKDVPANFEERLTDLLAESMNKPRNRIAIEVLAGQRITHGASRNPVAVIKVESIGALSADDNIRHTQKITQFCQDTLKLPKDKVIITYFDLQPIHVGFNGT",
        "middle": "MP++R++   + +++++A+++++L+++LA+++++PR++++IE++++Q  +++++++++++++V++++ ++++++++++Q+IT++++++   ++++V+I++++L++++++ NG+",
        "computed_K_ungapped": "0.1759",
        "computed_lambda_ungapped": "1.5201",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7641",
        "entropy": 0.4722,
        "expected_score": -0.2863,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "3C6V_A Probable tautomerase\/dehalogenase AU4130; Aspergillus fumigatus trimeric thermophilic probable tautomerase\/dehalogenase, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural; HET: MSE; 1.9A {Aspergillus fumigatus Af293}",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 161,
      "target_eno": 11.0,
      "alignment": {
        "score": 76.35,
        "bit_score": 83.6,
        "evalue": 1e-15,
        "pvalue": 1e-15,
        "n_identities": 13,
        "n_positives": 90,
        "n_gaps": 15,
        "aln_length": 119,
        "query_from": 1,
        "query_to": 105,
        "target_from": 22,
        "target_to": 139,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee       hhhhhhh hhhhhhhhhhh     eeeeeee     eeee         eeeeeee      hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeee      hhhhhhhhhhhhhhhhh       eeeeeeee     eee       eeeeeeee       hhhhhhhhhhhhhhhhhh      eeeeeeee    eeee  e",
        "query_aln": "MPHLRIR----GIEENKVAELSPTLINELAAIIKTPRESFTIELINS---QFFRDGKIDD-YPFVEVLWF---ARDQEVQDLVAQTITNQIRRA-D--YESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPRWLIQHSPNTLTPEEKSHLAQQITQAYVG-FGLPAFYVQVHFIEQPAGTSFIGGEQHPNFVALTIYHLARTMTSDEQRQGFLKRIDAFLTPMFEPKGIDWEYFVTEAPRDLWKINGL",
        "middle": "MP+++I+    +++++++++L++++++++++ +++P++++++++I++   ++F++G++++ ++++++++    ++++E++++++++I+++++++ +  ++++++++T+++++++++NG+",
        "computed_K_ungapped": "0.1687",
        "computed_lambda_ungapped": "1.3447",
        "estimated_K_gapped": "0.0022",
        "estimated_lambda_gapped": "0.6760",
        "entropy": 0.4515,
        "expected_score": -0.3004,
        "min_score": -3,
        "max_score": 4
      }
    }},
    {"hit_record": {
      "target_description": "sp|A5PK65|DOPD_BOVIN D-dopachrome decarboxylase OS=Bos taurus OX=9913 GN=DDT PE=3 SV=1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 118,
      "target_eno": 12.0,
      "alignment": {
        "score": 69.17,
        "bit_score": 83.5,
        "evalue": 1.1e-15,
        "pvalue": 1.1e-15,
        "n_identities": 15,
        "n_positives": 86,
        "n_gaps": 10,
        "aln_length": 114,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 113,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee     hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeee           hhhhhhhhhhhhhh     eeeeeee    eeee     eeeeeeeee     hhhhhhhhhhhhhhhhhhh     eeeeeeee    eee   e",
        "query_aln": "MPHLRIRG---IEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFAR--DQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPFVELDTSLPAGRV-PAGLEKRLCAATAAILSKPEDRVNVTVRSGLAMVVNGSAEPSAQLLVSSIGVVGTAEENRGHSARFFEFLTKELDLAEDRIMIRFFPLERWQIGKKGT",
        "middle": "MP+++++    ++++ +A+L+++L++++AAI+++P++++++++++ ++++ +++++ +++++V+++++  ++E++++++++++++++++   ++++++I+F++L++++++++G+",
        "computed_K_ungapped": "0.1803",
        "computed_lambda_ungapped": "1.4914",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7497",
        "entropy": 0.4744,
        "expected_score": -0.2936,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "6VVW_C Tautomerase; symmetric, fused, 4-oxalocrotonate tautomerase, ISOMERASE; 2.1A {Advenella mimigardefordensis DPN7}",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 128,
      "target_eno": 12.0,
      "alignment": {
        "score": 69.90,
        "bit_score": 83.1,
        "evalue": 1.5e-15,
        "pvalue": 1.5e-15,
        "n_identities": 15,
        "n_positives": 89,
        "n_gaps": 12,
        "aln_length": 117,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 117,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeee   e   hhhhhhh hhhhhhhhhhh     eeeeeee     eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee            ",
        "target_secstr": "  eeeeee      hhhhhhhhhhhhhhhhhhh     eeeeeeee     ee       eeeeeeee     hhhhhhhhhhhhhhhhhhh      eeeeeee            ",
        "query_aln": "MPHLRI---RGIEENKVAELSPTLINELAAIIKTPRESFTIELI---NSQFFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYE-NGQ",
        "target_aln": "MPILQVQVTAGRSQQQKTAFLQNATKVIEQTLNAALPSIRISLHEIEQQDSIVAGQVGAEFVNIVAFLLAGRNDEVKANFLAAINKTAVTTLDVSDSCIRTMLIDIAPEHMGVQEGL",
        "middle": "MP+L++   +G++++++++++++++++++++++++++S++I+L+   +++++++G++++ +++++++++A R++EV+++++++I+++++++   +++++++M++++++++++  +G+",
        "computed_K_ungapped": "0.1814",
        "computed_lambda_ungapped": "1.5221",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7651",
        "entropy": 0.4742,
        "expected_score": -0.2943,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "7MW7_A D-dopachrome decarboxylase; Mitogen inhibitory factor 2, Mutant, CYTOKINE, Lyase; 1.1A {Homo sapiens}",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 118,
      "target_eno": 12.0,
      "alignment": {
        "score": 68.48,
        "bit_score": 82.7,
        "evalue": 2e-15,
        "pvalue": 2e-15,
        "n_identities": 13,
        "n_positives": 89,
        "n_gaps": 10,
        "aln_length": 114,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 113,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee     hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeee           hhhhhhhhhhhhhh      eeeeee    eee      eeeeeee          hhhhhhhhhhhhhhhhh    eeeeeeee    eeee   ",
        "query_aln": "MPHLRIR---GIEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFA-R-DQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MGFLELDTNLPANRV-PAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGT",
        "middle": "M++L+++   +++++ +A+L+++L++++A+I+++P++++++++++ ++++ +++++ ++++++++++ + ++E++++++++++++++++   ++++++I+F++L++++++++G+",
        "computed_K_ungapped": "0.1744",
        "computed_lambda_ungapped": "1.4932",
        "estimated_K_gapped": "0.0022",
        "estimated_lambda_gapped": "0.7506",
        "entropy": 0.4802,
        "expected_score": -0.2940,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "3FWU_A Macrophage migration inhibitory factor-like protein; homotrimer, tautomerase, CYTOKINE; 1.8A {Leishmania major} SCOP: d.80.1.0",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 133,
      "target_eno": 11.0,
      "alignment": {
        "score": 70.44,
        "bit_score": 82.2,
        "evalue": 2.8e-15,
        "pvalue": 2.8e-15,
        "n_identities": 14,
        "n_positives": 82,
        "n_gaps": 10,
        "aln_length": 113,
        "query_from": 1,
        "query_to": 105,
        "target_from": 21,
        "target_to": 131,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "   eeee       hhhhhhhhhhhhhhhhhh      eeeeee     ee       eeeeeeee       hhhhhhhhhhhhhhhh     eeeeeee      eee  e",
        "query_aln": "MPHLRIR---GIEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPVIQTFVSTPLDHHKRENLAQVYRAVTRDVLGKPEDLVMMTFHDSTPMHFFGSTDPVACVRVEALGGYGPSEPEKVTSIVTAAITKECGIVADRIFVLYFS--PLHCGWNGT",
        "middle": "MP+++++   +++++K+++L++++++ +++++++P++++++++ +S  ++ ++++D +++V+V++++ ++++++++V++++T++I+++   + +++++++++  +++++ NG+",
        "computed_K_ungapped": "0.1632",
        "computed_lambda_ungapped": "1.4470",
        "estimated_K_gapped": "0.0021",
        "estimated_lambda_gapped": "0.7274",
        "entropy": 0.4615,
        "expected_score": -0.2869,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "6CUQ_B Macrophage migration inhibitory factor-like protein; SSGCID, Structural genomics, Seattle Structural Genomics Center for Infectious Disease, CYTOKINE; 2.45A {Entamoeba histolytica} SCOP: d.80.1.0, l.1.1.1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 121,
      "target_eno": 11.0,
      "alignment": {
        "score": 67.45,
        "bit_score": 81.9,
        "evalue": 3.3e-15,
        "pvalue": 3.3e-15,
        "n_identities": 19,
        "n_positives": 80,
        "n_gaps": 6,
        "aln_length": 111,
        "query_from": 1,
        "query_to": 105,
        "target_from": 9,
        "target_to": 119,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  eeee        eeeeeee   hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeee      hhhhhhhhhhhhhhhhhh     eeeeeeee             eeeeeeee    hhhhhhhhhhhhhhhhh       eeeeee     eeee   ",
        "query_aln": "MPHLRIR---GIEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDDYPFVEVLWFARDQEVQDLVAQTITNQIRRA-D--YESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPHALITLSADITEEIKKEIAHESMKILSEVIGKPISYCATQVVTSVGGFGGKIVKSAFIDIKSISGLKGKQEGLSDRYCKLLEQKAGIEGGNIYLNFTEMTGNNWGYDHS",
        "middle": "MPH+ I+    I+E++++E++++++++L+++I++P++++++++ +S ++++GKI++++F++++++++ +++Q++++++++++++++ +  +++++++FT++T+++++ +++",
        "computed_K_ungapped": "0.1913",
        "computed_lambda_ungapped": "1.4740",
        "estimated_K_gapped": "0.0025",
        "estimated_lambda_gapped": "0.7409",
        "entropy": 0.4467,
        "expected_score": -0.2873,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|O44786|MIFH_WUCBA Macrophage migration inhibitory factor homolog OS=Wuchereria bancrofti OX=6293 GN=MIF PE=3 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 115,
      "target_eno": 12.0,
      "alignment": {
        "score": 66.74,
        "bit_score": 81.3,
        "evalue": 5e-15,
        "pvalue": 5e-15,
        "n_identities": 16,
        "n_positives": 84,
        "n_gaps": 9,
        "aln_length": 113,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 112,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "   eeeee      h hhhhh                 eeeeee               eeeeeee        hhhhhhhhhhhhhh      eeeeeeeee    eee  e",
        "query_aln": "MPHLRIRG---IEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA-D--YESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPYFTIDTNKPQDSI-SSAFLKKAPNVVPKALGKPESYVSIHVNGGQPMVFGGSEDPCPVCVLKSIGCVGPKVNNSHAEKLYKLLADELKIPKNRCYIESVDIEASSMAFNGS",
        "middle": "MP+++I++   ++++ +++++++++N +++++++P+++++I+++++Q ++ G+++D +P++++++++ ++++V++++A++++++++++ +   ++++I+++++++S++++NG+",
        "computed_K_ungapped": "0.1648",
        "computed_lambda_ungapped": "1.5027",
        "estimated_K_gapped": "0.0021",
        "estimated_lambda_gapped": "0.7554",
        "entropy": 0.4707,
        "expected_score": -0.2841,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "7M58_A Tautomerase_3 domain-containing protein; HYDROLASE; HET: SO4; 2.45A {Corynebacterium halotolerans YIM 70093 = DSM 44683}",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 144,
      "target_eno": 12.0,
      "alignment": {
        "score": 69.92,
        "bit_score": 80.7,
        "evalue": 7.7e-15,
        "pvalue": 7.7e-15,
        "n_identities": 16,
        "n_positives": 83,
        "n_gaps": 13,
        "aln_length": 117,
        "query_from": 2,
        "query_to": 105,
        "target_from": 1,
        "target_to": 117,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeeee       hhhhhhh hhhhhhhhhhh     eeeeeee     eeee          eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": " eeeee       hhhhhhhhhhhhhhhhhh       eeeeeee     ee         eeeeeeeee    hhhhhhhhhhhhhhhhhh       eeeeee      eee  e",
        "query_aln": "PHLRIRG----IEENKVAELSPTLINELAAIIKTPRESFTIELIN---SQFFRDGKIDD--YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "PSYAVSSRAGLIDQERRAAVADLLTTLHRDIAVAPRYLVQVIFNDLDAGALFLAGREAPEGHVWIHADIRSGRTAQQKTDLLEQITSKVADVLELPPEHVWVYVNEIPGENMTEYGK",
        "middle": "P+++++     I+++++A+++++L++++++I+++PR+++++ +++     +F++G++++  ++++++++++ R+++++++++++IT++++++   + E+V+++++++++++++E+G+",
        "computed_K_ungapped": "0.1869",
        "computed_lambda_ungapped": "1.4536",
        "estimated_K_gapped": "0.0024",
        "estimated_lambda_gapped": "0.7307",
        "entropy": 0.4286,
        "expected_score": -0.2905,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "4JJ9_A 5-carboxymethyl-2-hydroxymuconate delta-isomerase; NYSGRC, PSI-Biology, Structural Genomics, New York Structural Genomics Research Consortium, alpha-beeta, trimer, homoprotocatechuate catabolic pathway, ISOMERASE; HET: MSE, SO4; 1.76A {Bordetella bronchiseptica} SCOP: l.1.1.1, d.80.1.0",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 167,
      "target_eno": 9.0,
      "alignment": {
        "score": 73.03,
        "bit_score": 80.6,
        "evalue": 8e-15,
        "pvalue": 8e-15,
        "n_identities": 15,
        "n_positives": 87,
        "n_gaps": 30,
        "aln_length": 135,
        "query_from": 1,
        "query_to": 105,
        "target_from": 23,
        "target_to": 157,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee       hhhhhhh hhhhhhhhhhh           eeeeeee   eeee                   eeeeeee    hhhhhhhhhhhhhhhhh            eeeeeee           ",
        "target_secstr": "  eeeeeee        hhhhhhhhhhhhhhh             eeeeee    ee                   eeeeeee     hhhhhhhhhhhhhhhhhhh        eeeeeeeee           ",
        "query_aln": "MPHLRIR---GIE-ENKVAELSPTLINELAAII------KTPRESFTIELIN-SQFFRDGK----------IDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA-D------YESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPHLVILYSGNLDRDLDMGAVCRGLADAMLTVRDDEGRQVFPTGGTRVLAYPAPHYAIADGGQAGRDAGESGDYGFAYLNLRMGRGRSEAVQRRAGETIAQAARALLAPLLQQRRVGLTFQIDVGAEVYDAKFGN",
        "middle": "MPHL+I+   +++ ++++++++++L++++++++      ++P++++++ +++ ++++++++          +D+ ++++++++++ R+++VQ+++++TI++++R++ +      + ++ ++++++++++++++G+",
        "computed_K_ungapped": "0.1750",
        "computed_lambda_ungapped": "1.3349",
        "estimated_K_gapped": "0.0022",
        "estimated_lambda_gapped": "0.6710",
        "entropy": 0.4471,
        "expected_score": -0.3155,
        "min_score": -3,
        "max_score": 4
      }
    }},
    {"hit_record": {
      "target_description": "6LR3_I Macrophage migration inhibitory factor; Oncomelania hupensis macrophage migration inhibitory factor, Isomerase, Beta-alpha-beta fold, CYTOKINE; HET: SO4; 1.77A {Oncomelania hupensis} SCOP: d.80.1.3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 131,
      "target_eno": 12.0,
      "alignment": {
        "score": 68.17,
        "bit_score": 80.4,
        "evalue": 9.4e-15,
        "pvalue": 9.4e-15,
        "n_identities": 17,
        "n_positives": 85,
        "n_gaps": 7,
        "aln_length": 112,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 112,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee     hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeee        hhhhhhhhhhhhhhh      eeeeeee   eeee       eeeeeeee    hhhhhhhhhhhhhhhhhh      eeeeeeee    eeee  e",
        "query_aln": "MPHLRIRGI--EENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPVITVNTNVAEKSIPVFFQAALTNMMTKALQKPKEVMFVDLRSGANIMMGGDRNPCVFATVECIGRLNPTSNLAMARDMEDMFIEHLNVRRERIVIRFIPVPALFCSFNGA",
        "middle": "MP++++++   E++++++++++L+N++++++++P+E+++++L+++ +++ G++++ ++F++V++++ +++++++++A++++++++++   ++E+++I+F++++++++++NG+",
        "computed_K_ungapped": "0.1663",
        "computed_lambda_ungapped": "1.5337",
        "estimated_K_gapped": "0.0021",
        "estimated_lambda_gapped": "0.7709",
        "entropy": 0.4843,
        "expected_score": -0.2860,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|O86237|Y138A_HAEIN Uncharacterized protein HI_1388.1 OS=Haemophilus influenzae (strain ATCC 51907 \/ DSM 11121 \/ KW20 \/ Rd) OX=71421 GN=HI_1388.1 PE=1 SV=1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 128,
      "target_eno": 12.0,
      "alignment": {
        "score": 67.74,
        "bit_score": 80.1,
        "evalue": 1.1e-14,
        "pvalue": 1.1e-14,
        "n_identities": 14,
        "n_positives": 87,
        "n_gaps": 11,
        "aln_length": 114,
        "query_from": 3,
        "query_to": 105,
        "target_from": 1,
        "target_to": 114,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "eeee   e   hhhhhhh hhhhhhhhhhh     eeeeeee  e   eee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": " eeeee      hhhhhhhhhhhhhhhh        eeeeeee               eeeeeeee      hhhhhhhhhhhhhhhhhh      eeeeee     eeee   ",
        "query_aln": "HLRI---RGIEENKVAELSPTLINELAAIIKTPRESFTIELINSQ---FFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA-D--YESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MITVFGLKSKLAPRREKLAEVIYNSLHLGLDIPKGKHAIRFLCLEKEDFYYPFDRSDDYTVIEINLMAGRMEGTKKRLIKMLFSELEYKLGIRAHDVEITIKEQPAHCWGFRGM",
        "middle": "++++   ++++++++++L+++++N+L++++++P+++++I +++++   F+++++++D Y+++E++++A R+++++++++++++++++++ +  +++V+I+++++++++++ +G+",
        "computed_K_ungapped": "0.1945",
        "computed_lambda_ungapped": "1.4910",
        "estimated_K_gapped": "0.0025",
        "estimated_lambda_gapped": "0.7495",
        "entropy": 0.4164,
        "expected_score": -0.2785,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "3B64_A Macrophage migration inhibitory factor-like protein; CYTOKINE, LEISHMANIA, MACROPHAGE MIGRATION INHIBITORY FACTOR, MIF, Lm1740MIF, LmMIF, UNKNOWN FUNCTION; 1.03A {Leishmania major} SCOP: d.80.1.0",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 112,
      "target_eno": 11.5,
      "alignment": {
        "score": 66.40,
        "bit_score": 80.0,
        "evalue": 1.2e-14,
        "pvalue": 1.2e-14,
        "n_identities": 13,
        "n_positives": 84,
        "n_gaps": 10,
        "aln_length": 112,
        "query_from": 2,
        "query_to": 105,
        "target_from": 1,
        "target_to": 110,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": " eeeeee     hhhhhhhhhhhhhhhhhh      eeeeeee    eee       eeeeeeee       hhhhhhhhhhhhhhhh      eeeeee      eee  e",
        "query_aln": "PHLRIR---GIEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "PVIQTFVSTPLDHHKRENLAQVYRAVTRDVLGKPEDLVMMTFHDSTPMHFFGSTDPVACVRVEALGGYGPSEPEKVTSIVTAAITKECGIVADRIFVLYFS--PLHCGWNGT",
        "middle": "P+++++   +++++K+++L++++++ +++++++P++++++++++S+ ++ ++++D +++V+V++++ ++++++++V++++T++I+++   +++++ +++++  +++++ NG+",
        "computed_K_ungapped": "0.1936",
        "computed_lambda_ungapped": "1.4274",
        "estimated_K_gapped": "0.0025",
        "estimated_lambda_gapped": "0.7175",
        "entropy": 0.4325,
        "expected_score": -0.3015,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "3MF7_A Cis-3-chloroacrylic acid dehalogenase; beta-alpha-beta motif, tautomerase, dehalogenase, cis-3-chloroacrylic acid dehalogenase, Isomerase, HYDROLASE; HET: PR4; 1.65A {coryneform bacterium}",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 149,
      "target_eno": 11.0,
      "alignment": {
        "score": 70.27,
        "bit_score": 79.9,
        "evalue": 1.3e-14,
        "pvalue": 1.3e-14,
        "n_identities": 15,
        "n_positives": 83,
        "n_gaps": 9,
        "aln_length": 108,
        "query_from": 7,
        "query_to": 105,
        "target_from": 10,
        "target_to": 117,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "e   hhhhhhh hhhhhhhhhhh     eeeeeee     eeee          eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "    hhhhhhhhhhhhhhhhhh      eeeeeeee     eee        eeeeeee      hhhhhhhhhhhhhhhhhhhh     eeeeeee      ee  e",
        "query_aln": "RGIEENKVAELSPTLINELAAIIKTPRESFTIELIN---SQFFRDGKI-DD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "DRLTPSAKHAVAKAITDAHRGLTGTQHFLAQVNFQEQPAGNVFLGGVQQGGDTIFVHGLHREGRSADLKGQLAQRIVDDVSVAAEIDRKHIWVYFGEMPAQQMVEYGR",
        "middle": " +++++++++++++++++++++++T+++++++++++   +++F++G++ ++ ++FV++L+++ R++++++++AQ+I++++++A   D+++++++F+++++++++E+G+",
        "computed_K_ungapped": "0.1762",
        "computed_lambda_ungapped": "1.3982",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7028",
        "entropy": 0.4116,
        "expected_score": -0.2853,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "7PUO_E 2-hydroxymuconate tautomerase,Chains: A,B,C,D,E,F,2-hydroxymuconate tautomerase; Protein engineering, 4-oxalocrotonate tautomerase, Michael addition, carbon-carbon lyase, LYASE; HET: GOL; 2.35A {Pseudomonas putida}",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 129,
      "target_eno": 12.0,
      "alignment": {
        "score": 67.61,
        "bit_score": 79.9,
        "evalue": 1.4e-14,
        "pvalue": 1.4e-14,
        "n_identities": 18,
        "n_positives": 82,
        "n_gaps": 18,
        "aln_length": 122,
        "query_from": 2,
        "query_to": 105,
        "target_from": 1,
        "target_to": 122,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeee   e   hhhhhhh hhhhhhhhhhh     eeeeeee  e   eee                eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": " eeeeee      hhhhhhhhhhhhhhhh        eeeeeee    eee                 eeeeee     hhhhhhhhhhhhhhhhhh      eeeeeeee    eeee   ",
        "query_aln": "PHLRI---RGIEENKVAELSPTLINELAAIIKTPRESFTIELINSQ---FFRDGKI---D-----DYPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "PIAQIHILEGHSDEQKETLIRDVSEAISRSDDATLSSVRVIITELAKGHFGIGGELASKVPRGGGAGPIAQIHILEGRSGEQKETLIREASEAISRSLDAPLKSVRIFITEIAKGHAGVGGE",
        "middle": "P+++I   +G++++++++L+++++++++++++++++S+++++++ +   F+++G+    +     ++P++++++++ R++E++++++++++++I+R+   + +SV+I++T+++K++++ +G+",
        "computed_K_ungapped": "0.1901",
        "computed_lambda_ungapped": "1.5090",
        "estimated_K_gapped": "0.0024",
        "estimated_lambda_gapped": "0.7585",
        "entropy": 0.4334,
        "expected_score": -0.2891,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "1MWW_A HYPOTHETICAL PROTEIN HI1388.1; I1388.1, STRUCTURAL GENOMICS, HYPOTHETICAL PROTEIN, Structure 2 Function Project, S2F, UNKNOWN FUNCTION; HET: GLU; 2.08A {Haemophilus influenzae} SCOP: d.80.1.4",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 128,
      "target_eno": 12.0,
      "alignment": {
        "score": 67.02,
        "bit_score": 79.7,
        "evalue": 1.6e-14,
        "pvalue": 1.6e-14,
        "n_identities": 15,
        "n_positives": 87,
        "n_gaps": 9,
        "aln_length": 114,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 114,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeee e   hhhhhhh hhhhhhhhhhh     eeeeeee     eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": " eeeee     hhhhhhhhhhhhhhhhh        eeeeeee                eeeeeee      hhhhhhhhhhhhhhhhhh      eeeeeee           ",
        "query_aln": "MPHLRI-RGIEENKVAELSPTLINELAAIIKTPRESFTIELINS---QFFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MITVFGLKSKLAPRREKLAEVIYNSLHLGLDIPKGKHAIRFLCLEKEDFYYPFDRSDDYTVIEINLMAGRMEGTKKRLIKMLFSELEYKLGIRAHDVEITIKEQPAHCWGFRGM",
        "middle": "M+++++  +++++++++L+++++N+L++++++P+++++I ++++   +F+++++++D Y+++E++++A R+++++++++++++++++++   ++++V+I+++++++++++ +G+",
        "computed_K_ungapped": "0.1919",
        "computed_lambda_ungapped": "1.4589",
        "estimated_K_gapped": "0.0025",
        "estimated_lambda_gapped": "0.7333",
        "entropy": 0.4085,
        "expected_score": -0.2821,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|P94502|YRDN_BACSU Probable tautomerase YrdN OS=Bacillus subtilis (strain 168) OX=224308 GN=yrdN PE=3 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 129,
      "target_eno": 12.0,
      "alignment": {
        "score": 66.20,
        "bit_score": 79.5,
        "evalue": 1.7e-14,
        "pvalue": 1.7e-14,
        "n_identities": 11,
        "n_positives": 89,
        "n_gaps": 15,
        "aln_length": 120,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 120,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee     eeee              eeeeeee   hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeeee     hhhhhhhhhhhhhhhhh       eeeeeee      eee           eeeeeeee    hhhhhhhhhhhhhhhhhh      eeeeeeee           ",
        "query_aln": "MPHLRIR---GIEENKVAELSPTLINELAAIIKTPRESFTIELINS---QFFR-----DGKIDD-YPFVEVLWFARDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPLLRFDLIEGRDQSSLKKLLDVAHNVVVEAFDVPQQDRYQIVHEHPENHMIIEDTGLGFNRTKNLVVLSVTSKSRPEEKKQKFYRLLAERLESECGIASTDLIVSIVENDNADWSFGLG",
        "middle": "MP+LR++   G++++++++L+++++N +++++++P++++++ ++++   ++++     ++++++ +++++V++ +R++E++++++++++++++++   + ++++++++++++++++ +++",
        "computed_K_ungapped": "0.1808",
        "computed_lambda_ungapped": "1.5512",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7798",
        "entropy": 0.4785,
        "expected_score": -0.2830,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q5ZMG0|DOPD_CHICK D-dopachrome decarboxylase OS=Gallus gallus OX=9031 GN=DDT PE=3 SV=1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 118,
      "target_eno": 12.0,
      "alignment": {
        "score": 65.92,
        "bit_score": 79.5,
        "evalue": 1.7e-14,
        "pvalue": 1.7e-14,
        "n_identities": 16,
        "n_positives": 86,
        "n_gaps": 10,
        "aln_length": 114,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 113,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  e eee        eeeeeee     hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "   eeee              hhhhhhhhhhh     eeeeeeee            eeeeeeee       hhhhhhhhhhhhhhhhhh     eeeeeeee          e",
        "query_aln": "MPHLRIR---GIEENKVAELSPTLINELAAIIKTPRESFTIELINSQ-FFRDGKIDDYPFVEVLWFAR--DQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPFVELETNLPAERL-PPGLPLKLCEATATILGKPAERVNVTVRSGMPMVLAGSAEPCAQLLVSSIGVVGSAQQNQGHSARFFDFLTTELGLGPERIVIRFYPLEPWQIGKNRT",
        "middle": "MP+++++   ++E++ +++L+++L++++A+I+++P+E++++++++ + ++++G+++++++++V+++++  +++++++++++++++++++   ++E+++I+F++L++++++ N++",
        "computed_K_ungapped": "0.1765",
        "computed_lambda_ungapped": "1.5045",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7563",
        "entropy": 0.4528,
        "expected_score": -0.2788,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|O35215|DOPD_MOUSE D-dopachrome decarboxylase OS=Mus musculus OX=10090 GN=Ddt PE=1 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 118,
      "target_eno": 12.0,
      "alignment": {
        "score": 65.89,
        "bit_score": 79.5,
        "evalue": 1.8e-14,
        "pvalue": 1.8e-14,
        "n_identities": 16,
        "n_positives": 83,
        "n_gaps": 10,
        "aln_length": 114,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 113,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee     hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "   eeeee         hhhhhhhhhhhhhh      eeeeeee   eeee      eeeeeeee      hhhhhhhhhhhhhhhhhh      eeeeeeee    eeee  e",
        "query_aln": "MPHLRIR---GIEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFAR--DQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPFVELETNLPASRI-PAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLVSSIGVVGTAEQNRTHSASFFKFLTEELSLDQDRIVIRFFPLEAWQIGKKGT",
        "middle": "MP+++++   +++++  A+L+++L++++A+I+++P++++++++++++ ++ +K+++ +++++V+++++  ++E++++++++++++++++   D ++++I+F++L++++++ +G+",
        "computed_K_ungapped": "0.1867",
        "computed_lambda_ungapped": "1.4869",
        "estimated_K_gapped": "0.0024",
        "estimated_lambda_gapped": "0.7474",
        "entropy": 0.4861,
        "expected_score": -0.3024,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "3FWT_A Macrophage migration inhibitory factor-like protein; homotrimer, tautomerase, CYTOKINE; 1.9A {Leishmania major} SCOP: d.80.1.0, l.1.1.1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 133,
      "target_eno": 11.0,
      "alignment": {
        "score": 66.64,
        "bit_score": 79.4,
        "evalue": 1.9e-14,
        "pvalue": 1.9e-14,
        "n_identities": 15,
        "n_positives": 84,
        "n_gaps": 10,
        "aln_length": 113,
        "query_from": 1,
        "query_to": 105,
        "target_from": 21,
        "target_to": 131,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "   eeeeeee     hh   hhhhhhhhhhh      eeeeeee             eeeeeee             hhhhhhhhhhh       eeeeeee     eee  e",
        "query_aln": "MPHLRIR---GIEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPFLQTIVSVSLDDQKRANLSAAYGMICREELGKPEDFVMTAFSDKTPISFQGSTAPAAYVRVESWGEYAPSKPKMMTPRIAAAITKECGIPAERIYVFYYST--KHCGWNGT",
        "middle": "MP+L+++   +++++K+A+LS+++++++++++++P++++++++++ + ++ +++++ +++V+V++++ ++++++++++++I+++I+++   ++E+++++++++  ++++ NG+",
        "computed_K_ungapped": "0.1499",
        "computed_lambda_ungapped": "1.4856",
        "estimated_K_gapped": "0.0019",
        "estimated_lambda_gapped": "0.7468",
        "entropy": 0.4527,
        "expected_score": -0.2686,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|A6NHG4|DDTL_HUMAN D-dopachrome decarboxylase-like protein OS=Homo sapiens OX=9606 GN=DDTL PE=2 SV=1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 134,
      "target_eno": 11.0,
      "alignment": {
        "score": 67.73,
        "bit_score": 78.9,
        "evalue": 2.7e-14,
        "pvalue": 2.7e-14,
        "n_identities": 11,
        "n_positives": 86,
        "n_gaps": 10,
        "aln_length": 112,
        "query_from": 1,
        "query_to": 103,
        "target_from": 1,
        "target_to": 111,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee     hhhhhhhhhhhhhhhhh        eeeeeee         ",
        "target_secstr": "  eeeee           hhhhhhhhhhhhhh     eeeeeee             eeeeeeeee     hhhhhhhhhhhhhhhhhhh     eeeeeeee         ",
        "query_aln": "MPHLRIRG---IEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFAR--DQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYEN",
        "target_aln": "MPFLELDTNLPANRV-PAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRFPTVLSTSPAAHGGPR",
        "middle": "MP+L+++    ++++  A+L+++L++++A+I+++P++++++++++++ ++ +++++ +++++++++++  ++E++++++++++++++++   ++++++++++T+++++++ +",
        "computed_K_ungapped": "0.1741",
        "computed_lambda_ungapped": "1.3995",
        "estimated_K_gapped": "0.0022",
        "estimated_lambda_gapped": "0.7035",
        "entropy": 0.4542,
        "expected_score": -0.3007,
        "min_score": -3,
        "max_score": 4
      }
    }},
    {"hit_record": {
      "target_description": "7MS0_A 4-oxalocrotonate tautomerase; tautomerase, HYDROLASE; 1.37A {Corynebacterium glutamicum}",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 163,
      "target_eno": 11.0,
      "alignment": {
        "score": 69.01,
        "bit_score": 78.7,
        "evalue": 3.1e-14,
        "pvalue": 3.1e-14,
        "n_identities": 14,
        "n_positives": 88,
        "n_gaps": 13,
        "aln_length": 117,
        "query_from": 2,
        "query_to": 105,
        "target_from": 1,
        "target_to": 117,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeeee       hhhhhhh hhhhhhhhhhh     eeeeeee     eeee          eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": " eeeeee      hhhhhhhhhhhhhhhhhh       eeeeeee     eeee        eeeeeeee    hhhhhhhhhhhhhhhhhhh     eeeeeeee    eeee  e",
        "query_aln": "PHLRIRG----IEENKVAELSPTLINELAAIIKTPRESFTIELIN---SQFFRDGKIDD--YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "PTYTCWSQRIRISREAKQRIAEAITDAHHELAHAPKYLVQVIFNEVEPDSYFIAAQSASENHIWVQATIRSGRTEKQKEELLLRLTQEIALILGIPNEEVWVYITEIPGSNMTEYGR",
        "middle": "P+++++     I++++++++++++++++++++++P++++++++++    ++F+++++++  +++V++++++ R++++++++++++T++I+++   ++E+V++++T++++S+++E+G+",
        "computed_K_ungapped": "0.1852",
        "computed_lambda_ungapped": "1.4765",
        "estimated_K_gapped": "0.0024",
        "estimated_lambda_gapped": "0.7422",
        "entropy": 0.4524,
        "expected_score": -0.2914,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "2AAL_D Malonate Semialdehyde Decarboxylase; tautomerase superfamily beta-alpha-beta homotrimeric, LYASE; HET: MLI; 1.65A {Pseudomonas pavonaceae} SCOP: d.80.1.6",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 131,
      "target_eno": 12.0,
      "alignment": {
        "score": 65.51,
        "bit_score": 78.4,
        "evalue": 3.8e-14,
        "pvalue": 3.8e-14,
        "n_identities": 11,
        "n_positives": 91,
        "n_gaps": 15,
        "aln_length": 120,
        "query_from": 1,
        "query_to": 105,
        "target_from": 1,
        "target_to": 120,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee     eeee              eeeeeee   hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeee     hhhhhhhhhhhhhhhhhh        eeeeee     eee            eeeeeee     hhhhhhhhhhhhhhhhhh       eeeeeee           ",
        "query_aln": "MPHLRIR---GIEENKVAELSPTLINELAAIIKTPRESFTIELINS---QFFRD-----GKIDD-YPFVEVLWFARDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "XPLLKFDLFYGRTDAQIKSLLDAAHGAMVDAFGVPANDRYQTVSQHRPGEMVLEDTGLGYGRSSAVVLLTVISRPRSEEQKVCFYKLLTGALERDCGISPDDVIVALVENSDADWSFGRG",
        "middle": "+P+L+++   G++++++++L++++++++++++++P+++++++++++   +++++     +++++ +++++V + +R++E+++++++++T++++R+   ++++V+++++++++++++ +++",
        "computed_K_ungapped": "0.1947",
        "computed_lambda_ungapped": "1.6014",
        "estimated_K_gapped": "0.0025",
        "estimated_lambda_gapped": "0.8050",
        "entropy": 0.4425,
        "expected_score": -0.2759,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "2WKB_D MACROPHAGE MIGRATION INHIBITORY FACTOR; CYTOKINE; HET: CME, GOL; 1.78A {PLASMODIUM BERGHEI} SCOP: d.80.1.0, l.1.1.1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 125,
      "target_eno": 12.0,
      "alignment": {
        "score": 64.29,
        "bit_score": 78.0,
        "evalue": 5.1e-14,
        "pvalue": 5.1e-14,
        "n_identities": 17,
        "n_positives": 82,
        "n_gaps": 8,
        "aln_length": 112,
        "query_from": 2,
        "query_to": 105,
        "target_from": 1,
        "target_to": 112,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": " eeeeeee     hhhhhhhhhhhhhhhhhh     eeeeee     eee      eeeeeeeee     hhhhhhhhhhhhhhhhh       eeeeeee     eee   ",
        "query_aln": "PHLRIR---GIEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "PCCELITNISIPDDKAQNTLSEIEDAISNILGKPVAYIMSNYDYQKNLRFSGSNEGYCFVRLTSIGGINRSNNSLLADKITKILSNHLSVKPRRVYIEFRDCSAQNFAFSGS",
        "middle": "P+++++   +I+++K +++++++++++++I+++P++++++++ + +++R +++++ Y+FV++++++ +++++++L+A++IT++++++   ++++V+I+F+++++++++ +G+",
        "computed_K_ungapped": "0.1799",
        "computed_lambda_ungapped": "1.6193",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.8140",
        "entropy": 0.4493,
        "expected_score": -0.2710,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "1HFO_B MIGRATION INHIBITORY FACTOR; TAUTOMERASE; 1.65A {TRICHINELLA SPIRALIS} SCOP: d.80.1.3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 113,
      "target_eno": 12.0,
      "alignment": {
        "score": 62.95,
        "bit_score": 76.8,
        "evalue": 1.1e-13,
        "pvalue": 1.1e-13,
        "n_identities": 11,
        "n_positives": 88,
        "n_gaps": 9,
        "aln_length": 112,
        "query_from": 2,
        "query_to": 105,
        "target_from": 1,
        "target_to": 111,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee  eeee         eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeee         hhhhhhhhhhhhhhh     eeeeeee   eee        eeeeeee       hhhhhhhhhhhhhhhh      eeeeeeee     eee   ",
        "query_aln": "PHLRIR---GIEENKVAELSPTLINELAAIIKTPRESFTIELINSQFFRDGKIDD-YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "PIFTLNTNIKATDV-PSDFLSSTSALVGNILSKPGSYVAVHINTDQQLSFGGSTNPAAFGTLMSIGGIEPSRNRDHSAKLFDHLNTKLGIPKNRMYIHFVNLNGDDVGWNGT",
        "middle": "P+++++   +++++  +++++++++++++I+++P+++++++++++Q+++ G++++ ++F+++++++ ++++++++++++++++++++   + ++++I+F++L++++++ NG+",
        "computed_K_ungapped": "0.1816",
        "computed_lambda_ungapped": "1.4959",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7520",
        "entropy": 0.4446,
        "expected_score": -0.2891,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "4U5R_C RhCC; beta-alpha-beta structural motif, magnesium binding enzyme, tautomerase superfamily, isomerase; 1.55A {Rhodococcus jostii}",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 152,
      "target_eno": 11.0,
      "alignment": {
        "score": 66.24,
        "bit_score": 75.1,
        "evalue": 3.8e-13,
        "pvalue": 3.8e-13,
        "n_identities": 13,
        "n_positives": 89,
        "n_gaps": 14,
        "aln_length": 118,
        "query_from": 2,
        "query_to": 105,
        "target_from": 1,
        "target_to": 118,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeeee       hhhhhhh hhhhhhhhhhh     eeeeeee     eeee         eeeeeee      hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": " eeeee         hhhhhhhhhhhhhhhhh      eeeeeee              eeeeeeee       hhhhhhhhhhhhhhhhhhhh      eeeeeee     ee    ",
        "query_aln": "PHLRIR---G-IEENKVAELSPTLINELAAIIKTPRESFTIELINS---QFFRDGKIDD-YPFVEVLWF---ARDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "PYWEIFTPENAFTPDDKEQLSEAITSIYVDYVNLPRFYVVVLFKDMPKETMYVGGKANNNFVRIRLDHIARQMETAEVRALMMTVAEEKLAPFIKERGYDWEIHIAETPMDLWRTQGL",
        "middle": "P+++I+   + ++++++++LS+++++++++++++PR++++++++++    ++++GK+++ +++++++++   ++++EV++L++++++++++++   ++++++I+++++++++++ +G+",
        "computed_K_ungapped": "0.1778",
        "computed_lambda_ungapped": "1.4111",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7093",
        "entropy": 0.4022,
        "expected_score": -0.2833,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "4LHP_J FG41 Malonate Semialdehyde Decarboxylase; The tautomerase Superfamily, beta-alpha-beta-motif, ISOMERASE; HET: PO4, SO4; 2.02A {coryneform bacterium} SCOP: d.80.1.0",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 136,
      "target_eno": 12.0,
      "alignment": {
        "score": 63.35,
        "bit_score": 74.1,
        "evalue": 7.3e-13,
        "pvalue": 7.3e-13,
        "n_identities": 15,
        "n_positives": 84,
        "n_gaps": 17,
        "aln_length": 119,
        "query_from": 2,
        "query_to": 104,
        "target_from": 1,
        "target_to": 118,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeeee      hhhhhhh hhhhhhhhhhh     eeeeeee     eeee              eeeee ee   hhhhhhhhhhhhhhhhh        eeeeeee          ",
        "target_secstr": " eeeeee     hhhhhhhhhhhhhhhhhhh      eeeeeee     eee            eeeeeeee     hhhhhhhhhhhhhhh hhh     eeeeeeee          ",
        "query_aln": "PHLRIR---GIEENKVAELSPTLINELAAIIKTPRESFTIELINS---QFFRDG-----KIDD-YPFVEVL-WFARDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENG",
        "target_aln": "PLIRIDLTSDRSREQRRAIADAVHDALVEVLAIPARDRFQILTAHDPSDIIAEDAGLGFQRSPSVVIIHVFTQAGRTIETKQRVFAAITESL-APIGVAGSDVFIAITENAPHDWSFGF",
        "middle": "P++RI+   +++++++++++++++++L++++++P++++++ L+++   ++++++     ++++ +++++V+ + +R++E++++V+++IT+++ ++   ++++V+I++T++++++++ ++",
        "computed_K_ungapped": "0.1894",
        "computed_lambda_ungapped": "1.5277",
        "estimated_K_gapped": "0.0024",
        "estimated_lambda_gapped": "0.7679",
        "entropy": 0.4453,
        "expected_score": -0.2873,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "6BGN_F 2-hydroxymuconate tautomerase; ISOMERASE; HET: 6Y5, NO3, GOL; 1.51A {Pseudomonas putida} SCOP: d.80.1.1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 60,
      "target_eno": 12.0,
      "alignment": {
        "score": 42.91,
        "bit_score": 58.2,
        "evalue": 4.4e-08,
        "pvalue": 4.4e-08,
        "n_identities": 10,
        "n_positives": 41,
        "n_gaps": 4,
        "aln_length": 55,
        "query_from": 55,
        "query_to": 105,
        "target_from": 1,
        "target_to": 55,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": " eeeeee     hhhhhhhhhhhhhhhhhh      eeeeeeee    eeee   ",
        "query_aln": "PFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "PIAQIHILEGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGE",
        "middle": "P++++++++ R++E++++++++++++I+R+   +++SV++++T+++K++++++G+",
        "computed_K_ungapped": "0.1914",
        "computed_lambda_ungapped": "1.5260",
        "estimated_K_gapped": "0.0025",
        "estimated_lambda_gapped": "0.7671",
        "entropy": 0.4606,
        "expected_score": -0.2906,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "4FDX_A 4-oxalocrotonase tautomerase isozyme; alpha\/beta barrel, 4OT, Tautomerase superfamily, isomerase; 1.64A {Methylibium petroleiphilum} SCOP: d.80.1.0",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 70,
      "target_eno": 12.0,
      "alignment": {
        "score": 44.39,
        "bit_score": 58.1,
        "evalue": 4.7e-08,
        "pvalue": 4.7e-08,
        "n_identities": 11,
        "n_positives": 39,
        "n_gaps": 4,
        "aln_length": 55,
        "query_from": 55,
        "query_to": 105,
        "target_from": 1,
        "target_to": 55,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": " eeeeee     hhhhhhhhhhhhhhhhhhh      eeeeee    hhhhh   ",
        "query_aln": "PFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "PIIQMNLLEGRTVEQKRNAVAAITEAVVRTLDVRPDQVRILINELGVEHFSVAGQ",
        "middle": "P++++++++ R++E++++++++IT++++R+   ++++V+I++++L++++++ +GQ",
        "computed_K_ungapped": "0.1971",
        "computed_lambda_ungapped": "1.5197",
        "estimated_K_gapped": "0.0025",
        "estimated_lambda_gapped": "0.7639",
        "entropy": 0.4508,
        "expected_score": -0.2969,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "7M59_A Tautomerase domain-containing protein; ISOMERASE; 1.65A {Gammaproteobacteria bacterium SG8_31} SCOP: d.80.1.0",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 64,
      "target_eno": 12.0,
      "alignment": {
        "score": 42.07,
        "bit_score": 56.1,
        "evalue": 2e-07,
        "pvalue": 2e-07,
        "n_identities": 8,
        "n_positives": 43,
        "n_gaps": 4,
        "aln_length": 55,
        "query_from": 55,
        "query_to": 105,
        "target_from": 1,
        "target_to": 55,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": " eeeeee     hhhhhhhhhhhhhhhhhh      eeeeeeee     eee   ",
        "query_aln": "PFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "PVIQCDIRQGRTAEQKQAMAEAITRAVHETIGAPVEYIYVLIRETPGAHHVKAGR",
        "middle": "P++++++++ R++E+++++A++IT++++++   ++E+++++++++++++++++G+",
        "computed_K_ungapped": "0.1850",
        "computed_lambda_ungapped": "1.5091",
        "estimated_K_gapped": "0.0024",
        "estimated_lambda_gapped": "0.7586",
        "entropy": 0.4598,
        "expected_score": -0.3025,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "2OPA_A Probable tautomerase ywhB; homohexamer, 4-Oxalocrotonate Tautomerase, inhibitor, 2-Fluoro-p-Hydroxycinnamate, ISOMERASE; HET: FHC; 2.4A {Bacillus subtilis} SCOP: d.80.1.0",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 61,
      "target_eno": 12.0,
      "alignment": {
        "score": 40.99,
        "bit_score": 55.3,
        "evalue": 3.5e-07,
        "pvalue": 3.5e-07,
        "n_identities": 10,
        "n_positives": 41,
        "n_gaps": 4,
        "aln_length": 55,
        "query_from": 55,
        "query_to": 105,
        "target_from": 1,
        "target_to": 55,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": " eeeeee     hhhhhhhhhhhhhhhhhh      eeeeeeee    eeeee  ",
        "query_aln": "PFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "PYVTVKMLEGRTDEQKRNLVEKVTEAVKETTGASEEKIVVFIEEMRKDHYAVAGK",
        "middle": "P+V+V++++ R++E+++++++++T++++++   ++E++++++++++K++Y+++G+",
        "computed_K_ungapped": "0.1831",
        "computed_lambda_ungapped": "1.5253",
        "estimated_K_gapped": "0.0024",
        "estimated_lambda_gapped": "0.7668",
        "entropy": 0.4594,
        "expected_score": -0.2932,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "4FAZ_B 4-oxalocrotonate isomerase protein; alpha\/beta fold, Tautomerase, ISOMERASE; 1.57A {Methylibium petroleiphilum} SCOP: d.80.1.0",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 62,
      "target_eno": 12.0,
      "alignment": {
        "score": 40.94,
        "bit_score": 55.1,
        "evalue": 3.9e-07,
        "pvalue": 3.9e-07,
        "n_identities": 11,
        "n_positives": 39,
        "n_gaps": 4,
        "aln_length": 55,
        "query_from": 55,
        "query_to": 105,
        "target_from": 1,
        "target_to": 55,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": " eeeeee     hhhhhhhhhhhhhhhhhh       eeeeeee    ee     ",
        "query_aln": "PFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "PFAQIYLIEGRTEEQKRAVIEKVTQAMMEAVGAPKENVRVWIHDVPKENWGIGGV",
        "middle": "PF++++ ++ R++E++++V++++T+++++A   ++E+V++++++++K++++++G+",
        "computed_K_ungapped": "0.1749",
        "computed_lambda_ungapped": "1.5015",
        "estimated_K_gapped": "0.0022",
        "estimated_lambda_gapped": "0.7548",
        "entropy": 0.4482,
        "expected_score": -0.2874,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q8KRR5|4OT_PSEFL 2-hydroxymuconate tautomerase OS=Pseudomonas fluorescens OX=294 GN=nahJ PE=3 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 63,
      "target_eno": 12.0,
      "alignment": {
        "score": 40.18,
        "bit_score": 53.6,
        "evalue": 1.1e-06,
        "pvalue": 1.1e-06,
        "n_identities": 9,
        "n_positives": 42,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeee     hhhhhhhhhhhhhhhhhh      eeeeeeee    eee    ",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPIAQLYILDGRSNEQKETLIREVSEAMSRSLDAPIERVRVIITEMPKNHFGIGGE",
        "middle": "+P++++ +++ R++E++++++++++++++R+   ++E+V++++T+++K++++++G+",
        "computed_K_ungapped": "0.1626",
        "computed_lambda_ungapped": "1.4809",
        "estimated_K_gapped": "0.0021",
        "estimated_lambda_gapped": "0.7444",
        "entropy": 0.4818,
        "expected_score": -0.2888,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "3MB2_A 4-oxalocrotonate tautomerase family enzyme - alpha subunit; TRANS-3-CHLOROACRYLIC ACID DEHALOGENASE, CAAD, DEHALOGENASE, HYDROLASE, 4-Oxalocrotonate tautomerase, 4-OT, heterohexamer, Isomerase; HET: SO4; 2.41A {Chloroflexus aurantiacus}",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 72,
      "target_eno": 12.0,
      "alignment": {
        "score": 40.95,
        "bit_score": 53.5,
        "evalue": 1.2e-06,
        "pvalue": 1.2e-06,
        "n_identities": 6,
        "n_positives": 44,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhhh       eeeeee     eeee   ",
        "query_aln": "YPFVEVLWF-ARDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MLLLRITMLEGRSTEQKAELARALSAAAAAAFDVPLAEVRLIIQEVPPTHWTVGGI",
        "middle": "+++++++++ +R++E+++++A+++++++++A   + ++V+++++++++++++ +G+",
        "computed_K_ungapped": "0.1815",
        "computed_lambda_ungapped": "1.5639",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7862",
        "entropy": 0.4927,
        "expected_score": -0.2888,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|P0DF84|Y797_STRP3 Probable tautomerase SpyM3_0797 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 \/ MGAS315) OX=198466 GN=SpyM3_0797 PE=3 SV=1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 61,
      "target_eno": 12.0,
      "alignment": {
        "score": 39.42,
        "bit_score": 53.0,
        "evalue": 1.7e-06,
        "pvalue": 1.7e-06,
        "n_identities": 14,
        "n_positives": 37,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeee      hhhhhhhhhhhhhhhhhhh      eeeeee            ",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPFVTIDLFEGRSQEQKNQLAREVTEVVSRIAKAPKENIHVFINDMPEGTYYPQGE",
        "middle": "+PFV++++F+ R+QE+++++A+++T++++R+   ++E+++++++++++++YY +G+",
        "computed_K_ungapped": "0.1714",
        "computed_lambda_ungapped": "1.5247",
        "estimated_K_gapped": "0.0022",
        "estimated_lambda_gapped": "0.7664",
        "entropy": 0.4662,
        "expected_score": -0.2806,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q89DI3|Y7456_BRADU Probable tautomerase bsl7456 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 \/ BCRC 13528 \/ IAM 13628 \/ NBRC 14792 \/ USDA 110) OX=224911 GN=bsl7456 PE=3 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 67,
      "target_eno": 12.0,
      "alignment": {
        "score": 40.11,
        "bit_score": 52.9,
        "evalue": 1.8e-06,
        "pvalue": 1.8e-06,
        "n_identities": 10,
        "n_positives": 42,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeee      hhhhhhhhhhhhhhhhhh       eeeeeee    eee    ",
        "query_aln": "YPFVEVLWF-ARDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPEITVSMAEGRTDEQKAGMMRDITQALVKNLGVDADAVVIQINEAPLRHKMKGGK",
        "middle": "+P+++V+++ +R++E++++++++IT++++++   D+++V+I+++++++++++++G+",
        "computed_K_ungapped": "0.1763",
        "computed_lambda_ungapped": "1.5066",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7573",
        "entropy": 0.4975,
        "expected_score": -0.2942,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "3EJ9_D Beta-subunit of trans-3-chloroacrylic acid dehalogenase; trans-3-chloroacrylic acid dehalogenase, CaaD, dehalogenase, Isomerase, HYDROLASE; 1.5A {Pseudomonas pavonaceae} SCOP: d.80.1.1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 70,
      "target_eno": 12.0,
      "alignment": {
        "score": 39.99,
        "bit_score": 52.6,
        "evalue": 2.1e-06,
        "pvalue": 2.1e-06,
        "n_identities": 5,
        "n_positives": 45,
        "n_gaps": 4,
        "aln_length": 55,
        "query_from": 55,
        "query_to": 105,
        "target_from": 1,
        "target_to": 55,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeee     hhhhhhhhhhhhhhhhhh       eeeeeee     eee   ",
        "query_aln": "PFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "PFIECHIATGLSVARKQQLIRDVIDVTNKSIGSDPKIINVLLVEHAEANMSISGR",
        "middle": "PF+E+++++ +++++++++++++++ ++++   D+++++++++++++++++++G+",
        "computed_K_ungapped": "0.1842",
        "computed_lambda_ungapped": "1.5899",
        "estimated_K_gapped": "0.0024",
        "estimated_lambda_gapped": "0.7992",
        "entropy": 0.4398,
        "expected_score": -0.2724,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "3M20_C 4-oxalocrotonate tautomerase, putative; 4-oxalocrotonate tautomerase, Archaeoglobus fulgidus, DmpI, thermophile, beta-alpha-beta, catalytic proline, ISOMERASE; 2.37A {Archaeoglobus fulgidus}",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 62,
      "target_eno": 12.0,
      "alignment": {
        "score": 39.49,
        "bit_score": 52.5,
        "evalue": 2.3e-06,
        "pvalue": 2.3e-06,
        "n_identities": 7,
        "n_positives": 42,
        "n_gaps": 3,
        "aln_length": 54,
        "query_from": 55,
        "query_to": 105,
        "target_from": 1,
        "target_to": 54,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeeeeee   hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": " eeeee     hhhhhhhhhhhhhhhhhhh      eeeeee      ee    ",
        "query_aln": "PFVEVLWFARDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "PVLIVYGPKLDVGKKREFVERLTSVAAEIYGMDRSAITILIHEPPAENVGVGGK",
        "middle": "P+++V+ +++D+++++++++++T++++++   D+++++I+++++++++++ +G+",
        "computed_K_ungapped": "0.1921",
        "computed_lambda_ungapped": "1.5095",
        "estimated_K_gapped": "0.0025",
        "estimated_lambda_gapped": "0.7588",
        "entropy": 0.4317,
        "expected_score": -0.2854,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "3MB2_H 4-oxalocrotonate tautomerase family enzyme - beta subunit; TRANS-3-CHLOROACRYLIC ACID DEHALOGENASE, CAAD, DEHALOGENASE, HYDROLASE, 4-Oxalocrotonate tautomerase, 4-OT, heterohexamer, Isomerase; HET: SO4; 2.41A {Chloroflexus aurantiacus}",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 72,
      "target_eno": 11.0,
      "alignment": {
        "score": 40.87,
        "bit_score": 52.4,
        "evalue": 2.5e-06,
        "pvalue": 2.5e-06,
        "n_identities": 6,
        "n_positives": 42,
        "n_gaps": 8,
        "aln_length": 57,
        "query_from": 55,
        "query_to": 105,
        "target_from": 1,
        "target_to": 55,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeeeeee      hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeee        hhhhhhhhhhhhhhhhhhh      eeeeeee     ee  ee",
        "query_aln": "PFVEVLWFAR---DQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "PMLEVFYSGDRPPDRTRKQAFAAEASAIFQRVIGTPPGRLQLIIQIVSPENTL--AV",
        "middle": "P++EV+ +++   D+++++++A++++++++R+   ++++++++++++++++++  ++",
        "computed_K_ungapped": "0.1910",
        "computed_lambda_ungapped": "1.3761",
        "estimated_K_gapped": "0.0025",
        "estimated_lambda_gapped": "0.6918",
        "entropy": 0.4020,
        "expected_score": -0.2972,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q5HPH8|Y934_STAEQ Probable tautomerase SERP0934 OS=Staphylococcus epidermidis (strain ATCC 35984 \/ RP62A) OX=176279 GN=SERP0934 PE=3 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 61,
      "target_eno": 13.0,
      "alignment": {
        "score": 39.18,
        "bit_score": 52.0,
        "evalue": 3.3e-06,
        "pvalue": 3.3e-06,
        "n_identities": 9,
        "n_positives": 41,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeee     hhhhhhhhhhhhhhhhhh       eeeeeee    eeee   ",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPIINVKLLEGRSDEQLKDLVTEVTHAVEKTTGANKEAIHVVIEEMRKDHYAVGGV",
        "middle": "+P+++V++++ R++E+++++++++T++++++   + E++++++++++K++Y+ +G+",
        "computed_K_ungapped": "0.1651",
        "computed_lambda_ungapped": "1.5333",
        "estimated_K_gapped": "0.0021",
        "estimated_lambda_gapped": "0.7708",
        "entropy": 0.5218,
        "expected_score": -0.2853,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "2X4K_A 4-OXALOCROTONATE TAUTOMERASE; ISOMERASE; HET: PO4; 1.1A {STAPHYLOCOCCUS AUREUS} SCOP: d.80.1.0, l.1.1.1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 63,
      "target_eno": 12.0,
      "alignment": {
        "score": 38.35,
        "bit_score": 52.0,
        "evalue": 3.5e-06,
        "pvalue": 3.5e-06,
        "n_identities": 8,
        "n_positives": 41,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 3,
        "target_to": 58,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeee     hhhhhhhhhhhhhhhhhh      eeeeeeee    eeeee  ",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPIVNVKLLEGRSDEQLKNLVSEVTDAVEKTTGANRQAIHVVIEEMKPNHYGVAGV",
        "middle": "+P+V+V++++ R++E+++++++++T++++++   + + ++++++++++++Y+ +G+",
        "computed_K_ungapped": "0.1914",
        "computed_lambda_ungapped": "1.6673",
        "estimated_K_gapped": "0.0025",
        "estimated_lambda_gapped": "0.8381",
        "entropy": 0.5072,
        "expected_score": -0.2826,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "3M21_A Probable tautomerase HP_0924; 4-oxalocrotonate tautomerase, catalytic proline, hexamer, beta-alpha-beta, ISOMERASE; 1.9A {Helicobacter pylori} SCOP: d.80.1.0",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 67,
      "target_eno": 12.0,
      "alignment": {
        "score": 39.50,
        "bit_score": 51.6,
        "evalue": 4.5e-06,
        "pvalue": 4.5e-06,
        "n_identities": 6,
        "n_positives": 42,
        "n_gaps": 7,
        "aln_length": 58,
        "query_from": 55,
        "query_to": 105,
        "target_from": 1,
        "target_to": 58,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeeeeee       hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": " eeeeeee       hhhhhhhhhhhhhhhhhhh     eeeeeeee     ee    ",
        "query_aln": "PFVEVLWFAR----DQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "PFINIKLVPENGGPTNEQKQQLIEGVSDLMVKVLNKNKASIVVIIDEVDSNNYGLGGE",
        "middle": "PF+++++++     ++E++++++++++++++++   + +S++++++++++++Y+ +G+",
        "computed_K_ungapped": "0.1934",
        "computed_lambda_ungapped": "1.4657",
        "estimated_K_gapped": "0.0025",
        "estimated_lambda_gapped": "0.7368",
        "entropy": 0.4348,
        "expected_score": -0.2998,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q01468|4OT1_PSEPU 2-hydroxymuconate tautomerase OS=Pseudomonas putida OX=303 GN=xylH PE=1 SV=2",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 63,
      "target_eno": 12.0,
      "alignment": {
        "score": 38.24,
        "bit_score": 51.3,
        "evalue": 5.3e-06,
        "pvalue": 5.3e-06,
        "n_identities": 10,
        "n_positives": 42,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhhh       eeeeeee    eeee  e",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPIAQIHILEGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGE",
        "middle": "+P++++++++ R++E++++++++++++I+R+   +++SV++++T+++K++++++G+",
        "computed_K_ungapped": "0.1695",
        "computed_lambda_ungapped": "1.5558",
        "estimated_K_gapped": "0.0022",
        "estimated_lambda_gapped": "0.7821",
        "entropy": 0.4967,
        "expected_score": -0.2898,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|P49172|4OT_PSEUF 2-hydroxymuconate tautomerase OS=Pseudomonas sp. (strain CF600) OX=79676 GN=dmpI PE=1 SV=2",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 63,
      "target_eno": 12.0,
      "alignment": {
        "score": 38.42,
        "bit_score": 51.0,
        "evalue": 6.8e-06,
        "pvalue": 6.8e-06,
        "n_identities": 8,
        "n_positives": 44,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhhh      eeeeeeee    eee    ",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPIAQLYIIEGRTDEQKETLIRQVSEAMANSLDAPLERVRVLITEMPKNHFGIGGE",
        "middle": "+P++++++++ R++E++++++++++++++++   ++E+V++++T+++K++++++G+",
        "computed_K_ungapped": "0.1635",
        "computed_lambda_ungapped": "1.5228",
        "estimated_K_gapped": "0.0021",
        "estimated_lambda_gapped": "0.7655",
        "entropy": 0.5065,
        "expected_score": -0.2970,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q8XRG1|Y4393_RALSO Probable tautomerase RSp0893 OS=Ralstonia solanacearum (strain GMI1000) OX=267608 GN=RSp0893 PE=3 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 70,
      "target_eno": 12.0,
      "alignment": {
        "score": 39.23,
        "bit_score": 50.9,
        "evalue": 6.9e-06,
        "pvalue": 6.9e-06,
        "n_identities": 9,
        "n_positives": 42,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhhhh      eeeeee      eeee  ",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPLIQVTLIEGRTMEAKAALIGSLTQAAVATLGAPRESVRVIIQEVPAAHWGVAGV",
        "middle": "+P+++V++++ R++E+++++++++T++++++   ++ESV+++++++++++++ +G+",
        "computed_K_ungapped": "0.1745",
        "computed_lambda_ungapped": "1.4758",
        "estimated_K_gapped": "0.0022",
        "estimated_lambda_gapped": "0.7418",
        "entropy": 0.4432,
        "expected_score": -0.2749,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "3EJ9_E Alpha-subunit of trans-3-chloroacrylic acid dehalogenase; trans-3-chloroacrylic acid dehalogenase, CaaD, dehalogenase, Isomerase, HYDROLASE; 1.5A {Pseudomonas pavonaceae} SCOP: d.80.1.1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 76,
      "target_eno": 12.0,
      "alignment": {
        "score": 39.86,
        "bit_score": 50.9,
        "evalue": 7.3e-06,
        "pvalue": 7.3e-06,
        "n_identities": 7,
        "n_positives": 44,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeee       hhhhhhhhhhhhhhhhhh       eeeeeee    eeee   ",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPMISCDMRYGRTDEQKRALSAGLLRVISEATGEPRENIFFVIREGSGINFVQHGE",
        "middle": "+P++++++++ R++E++++++++++++I++A   ++E+++++++++++++++ +G+",
        "computed_K_ungapped": "0.1719",
        "computed_lambda_ungapped": "1.4775",
        "estimated_K_gapped": "0.0022",
        "estimated_lambda_gapped": "0.7427",
        "entropy": 0.4480,
        "expected_score": -0.2798,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q8XQR9|Y4651_RALSO Probable tautomerase RSp1151 OS=Ralstonia solanacearum (strain GMI1000) OX=267608 GN=RSp1151 PE=3 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 65,
      "target_eno": 12.0,
      "alignment": {
        "score": 38.08,
        "bit_score": 50.9,
        "evalue": 7.3e-06,
        "pvalue": 7.3e-06,
        "n_identities": 15,
        "n_positives": 37,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeee     hhhhhhhhhhhhhhhhhh      eeeeeeee           ",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPVVRVSWFEGKDAKAKKAVAAEITDSIVKHAGTDPKYIYVIFEDIKPSDWAGAGR",
        "middle": "+P+V+V+WF+ +D++++++VA++IT++I+++   D+++++++F+++++S+++++G+",
        "computed_K_ungapped": "0.1678",
        "computed_lambda_ungapped": "1.5518",
        "estimated_K_gapped": "0.0022",
        "estimated_lambda_gapped": "0.7801",
        "entropy": 0.5150,
        "expected_score": -0.2887,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "6OGM_C 4-oxalocrotonate tautomerase; HYDROLASE; HET: FMT, GOL; 1.865A {Burkholderia lata (strain ATCC 17760 \/ DSM 23089 \/ LMG 22485 \/ NCIMB 9086 \/ R18194 \/ 383)} SCOP: d.80.1.0",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 65,
      "target_eno": 12.0,
      "alignment": {
        "score": 38.87,
        "bit_score": 50.5,
        "evalue": 9.3e-06,
        "pvalue": 9.3e-06,
        "n_identities": 12,
        "n_positives": 37,
        "n_gaps": 4,
        "aln_length": 55,
        "query_from": 55,
        "query_to": 105,
        "target_from": 1,
        "target_to": 55,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": " eeeee      hhhhhhhhhhhhhhhhhh      eeeeeeee           ",
        "query_aln": "PFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "PTLEVFLPAGHDDARKAELIARLTGATVDSIGAPIESVRVLLTELPATHIGLGGR",
        "middle": "P++EV++ A +D+++++++++++T++++++   ++ESV++++T+L++++++ +G+",
        "computed_K_ungapped": "0.1861",
        "computed_lambda_ungapped": "1.4441",
        "estimated_K_gapped": "0.0024",
        "estimated_lambda_gapped": "0.7259",
        "entropy": 0.4211,
        "expected_score": -0.2937,
        "min_score": -3,
        "max_score": 2
      }
    }},
    {"hit_record": {
      "target_description": "3RY0_B Putative tautomerase; 4 oxalocrotonate tautomerase family, tautomerase, ISOMERASE; 1.4A {Streptomyces achromogenes}",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 65,
      "target_eno": 12.0,
      "alignment": {
        "score": 38.38,
        "bit_score": 50.5,
        "evalue": 9.4e-06,
        "pvalue": 9.4e-06,
        "n_identities": 7,
        "n_positives": 42,
        "n_gaps": 4,
        "aln_length": 55,
        "query_from": 55,
        "query_to": 105,
        "target_from": 1,
        "target_to": 55,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": " eeeee      hhhhhhhhhhhhhhhhhh       eeeeee     eeee   ",
        "query_aln": "PFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "PLIRVTLLEGRSPQEVAALGEALTAAAHETLGTPVEAVRVIVEETPPERWFVGGR",
        "middle": "P+++V++++ R++++++++++++T++++++   + E+V+++++++++++++ +G+",
        "computed_K_ungapped": "0.1938",
        "computed_lambda_ungapped": "1.5227",
        "estimated_K_gapped": "0.0025",
        "estimated_lambda_gapped": "0.7654",
        "entropy": 0.4376,
        "expected_score": -0.2882,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|P45418|Y2002_DICD3 Probable tautomerase K2 OS=Dickeya dadantii (strain 3937) OX=198628 GN=Dda3937_02002 PE=3 SV=4",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 67,
      "target_eno": 12.0,
      "alignment": {
        "score": 38.15,
        "bit_score": 50.4,
        "evalue": 1e-05,
        "pvalue": 1e-05,
        "n_identities": 6,
        "n_positives": 45,
        "n_gaps": 5,
        "aln_length": 57,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 57,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee     hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "   eeeeee     hhhhhhhhhhhhhhhhhhh     eeeeeeee           ",
        "query_aln": "YPFVEVLWF--ARDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPFVNIRITKDGVTAEQKKQLIAGVTQLLVDTLGKNPATTVVIIDEVETDNWGIGGE",
        "middle": "+PFV+++++  ++++E+++++++++T++++++   ++++++++++++++++++ +G+",
        "computed_K_ungapped": "0.1633",
        "computed_lambda_ungapped": "1.5745",
        "estimated_K_gapped": "0.0021",
        "estimated_lambda_gapped": "0.7915",
        "entropy": 0.4885,
        "expected_score": -0.2711,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|P67530|Y1017_STRPN Probable tautomerase SP_1017 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 \/ TIGR4) OX=170187 GN=SP_1017 PE=3 SV=2",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 60,
      "target_eno": 13.0,
      "alignment": {
        "score": 37.62,
        "bit_score": 50.4,
        "evalue": 1e-05,
        "pvalue": 1e-05,
        "n_identities": 12,
        "n_positives": 40,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "   eeeee     hhhhhhhhhhhhhhhhhh      eeeeeee     eee    ",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPFVRIDLFEGRTLEQKKALAKEVTEAVVRNTGAPQSAVHVIINDMPEGTYFPQGE",
        "middle": "+PFV++++F+ R++E+++++A+++T++++R+   ++++V+++++++++++Y+++G+",
        "computed_K_ungapped": "0.1787",
        "computed_lambda_ungapped": "1.5652",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7868",
        "entropy": 0.5017,
        "expected_score": -0.2872,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q4L670|Y1546_STAHJ Probable tautomerase SH1546 OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=SH1546 PE=3 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 62,
      "target_eno": 13.0,
      "alignment": {
        "score": 38.00,
        "bit_score": 50.1,
        "evalue": 1.2e-05,
        "pvalue": 1.2e-05,
        "n_identities": 10,
        "n_positives": 41,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeee     hhhhhhhhhhhhhhhhhhh      eeeeeee     eeee  ",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPIINVKLLEGRSDEQLKNLVTEVTNAVEKTTGANREAIHVIIEEMQKNHYGVAGV",
        "middle": "+P+++V++++ R++E+++++++++TN+++++   + E++++++++++K++Y+++G+",
        "computed_K_ungapped": "0.1813",
        "computed_lambda_ungapped": "1.5042",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7561",
        "entropy": 0.4657,
        "expected_score": -0.2913,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q9ZI54|4OT_PSEST 2-hydroxymuconate tautomerase OS=Pseudomonas stutzeri OX=316 GN=nahJ PE=3 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 63,
      "target_eno": 13.0,
      "alignment": {
        "score": 38.03,
        "bit_score": 49.8,
        "evalue": 1.5e-05,
        "pvalue": 1.5e-05,
        "n_identities": 10,
        "n_positives": 41,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeee     hhhhhhhhhhhhhhhhhh      eeeeeeee   eee     ",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPIAQIHILEGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMPKVHFGIGGE",
        "middle": "+P++++++ + R++E++++++++++++I+R+   +++SV++++T+++K++++++G+",
        "computed_K_ungapped": "0.1664",
        "computed_lambda_ungapped": "1.5094",
        "estimated_K_gapped": "0.0021",
        "estimated_lambda_gapped": "0.7588",
        "entropy": 0.4769,
        "expected_score": -0.2878,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q830C9|Y2859_ENTFA Probable tautomerase EF_2859 OS=Enterococcus faecalis (strain ATCC 700802 \/ V583) OX=226185 GN=EF_2859 PE=3 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 59,
      "target_eno": 12.0,
      "alignment": {
        "score": 36.64,
        "bit_score": 49.7,
        "evalue": 1.7e-05,
        "pvalue": 1.7e-05,
        "n_identities": 13,
        "n_positives": 37,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "   eeee      hhhhhhhhhhhhhhhhhh       eeeeeee     eee   ",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPFVHVELIEGRTEEQLTNMVKDITEAVSKNAGAPKENIHVIVNELKKDRYAQGGE",
        "middle": "+PFV+V +++ R++E++++++++IT++++++   ++E++++++++L+K++Y+ +G+",
        "computed_K_ungapped": "0.1782",
        "computed_lambda_ungapped": "1.5790",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7937",
        "entropy": 0.4862,
        "expected_score": -0.2810,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|P70994|4OT_BACSU 2-hydroxymuconate tautomerase OS=Bacillus subtilis (strain 168) OX=224308 GN=ywhB PE=1 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 62,
      "target_eno": 13.0,
      "alignment": {
        "score": 36.88,
        "bit_score": 49.1,
        "evalue": 2.5e-05,
        "pvalue": 2.5e-05,
        "n_identities": 10,
        "n_positives": 41,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "   eeeee     hhhhhhhhhhhhhhhhhh      eeeeeeee    eeee   ",
        "query_aln": "YPFVEVLWF-ARDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPYVTVKMLEGRTDEQKRNLVEKVTEAVKETTGASEEKIVVFIEEMRKDHYAVAGK",
        "middle": "+P+V+V+++ +R++E+++++++++T++++++   ++E++++++++++K++Y+ +G+",
        "computed_K_ungapped": "0.1772",
        "computed_lambda_ungapped": "1.5508",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7795",
        "entropy": 0.4866,
        "expected_score": -0.2800,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "6OGM_K 4-oxalocrotonate tautomerase; HYDROLASE; HET: FMT, GOL; 1.865A {Burkholderia lata (strain ATCC 17760 \/ DSM 23089 \/ LMG 22485 \/ NCIMB 9086 \/ R18194 \/ 383)} SCOP: d.80.1.0",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 64,
      "target_eno": 12.0,
      "alignment": {
        "score": 36.39,
        "bit_score": 48.9,
        "evalue": 2.8e-05,
        "pvalue": 2.8e-05,
        "n_identities": 7,
        "n_positives": 43,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 2,
        "target_to": 57,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhhh       eeeeee      eee   ",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPVIVAILIAGRTDEQKRALIAALSETSASVLDAPLQATRVMIKDIPNTDFGIGGQ",
        "middle": "+P++++ ++A R++E++++++++++++++++   +++++++M++++++++++ +GQ",
        "computed_K_ungapped": "0.1736",
        "computed_lambda_ungapped": "1.6999",
        "estimated_K_gapped": "0.0022",
        "estimated_lambda_gapped": "0.8545",
        "entropy": 0.5328,
        "expected_score": -0.2818,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q9PIM5|Y270_CAMJE Probable tautomerase Cj0270 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 \/ NCTC 11168) OX=192222 GN=Cj0270 PE=3 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 68,
      "target_eno": 12.0,
      "alignment": {
        "score": 37.26,
        "bit_score": 48.9,
        "evalue": 2.8e-05,
        "pvalue": 2.8e-05,
        "n_identities": 8,
        "n_positives": 41,
        "n_gaps": 5,
        "aln_length": 57,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 57,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee     hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "   eeeee      hhhhhhhhhhhhhhhhhh      eeeeeeee     eee   ",
        "query_aln": "YPFVEVLWFA--RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPLVNIKLAKPSLSKEQKAELIADITELLSTKYNKSKERVVVVLEDVENYDIGFGGE",
        "middle": "+P+V++ + +  +++E++++++++IT++++++   ++E+V+++++++++++++ +G+",
        "computed_K_ungapped": "0.1768",
        "computed_lambda_ungapped": "1.5876",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7981",
        "entropy": 0.5026,
        "expected_score": -0.2811,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q49XG3|Y1389_STAS1 Probable tautomerase SSP1389 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 \/ DSM 20229 \/ NCIMB 8711 \/ NCTC 7292 \/ S-41) OX=342451 GN=SSP1389 PE=3 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 61,
      "target_eno": 13.0,
      "alignment": {
        "score": 36.45,
        "bit_score": 48.6,
        "evalue": 3.6e-05,
        "pvalue": 3.6e-05,
        "n_identities": 12,
        "n_positives": 38,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "   eeeee     hhhhhhhhhhhhhhhhhhh     eeeeeeee    eeee   ",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPIVNVKLLEGRSDEQLKNLVTEVTNAVEKTTGANKEAIQIVIEEMKASHYGVAGV",
        "middle": "+P+V+V+++  R++E+++++++++TN+++++   + E+++I+++++++S+Y+++G+",
        "computed_K_ungapped": "0.1780",
        "computed_lambda_ungapped": "1.5845",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7965",
        "entropy": 0.5033,
        "expected_score": -0.2829,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q88WD0|Y1712_LACPL Probable tautomerase lp_1712 OS=Lactobacillus plantarum (strain ATCC BAA-793 \/ NCIMB 8826 \/ WCFS1) OX=220668 GN=lp_1712 PE=3 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 64,
      "target_eno": 13.0,
      "alignment": {
        "score": 36.83,
        "bit_score": 48.0,
        "evalue": 5.5e-05,
        "pvalue": 5.5e-05,
        "n_identities": 11,
        "n_positives": 40,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhhh      eeeeeeee    eeee   ",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPIVHIDLIAGRSQEQLKNLVKDVTDAVSKNTGAPAEHIHVILSEMQKNRYSVGGV",
        "middle": "+P+V+++++A R+QE+++++++++T++++++   ++E++++++++++K++Y+ +G+",
        "computed_K_ungapped": "0.1724",
        "computed_lambda_ungapped": "1.4881",
        "estimated_K_gapped": "0.0022",
        "estimated_lambda_gapped": "0.7480",
        "entropy": 0.4549,
        "expected_score": -0.2818,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "3ABF_D 4-oxalocrotonate tautomerase; tautomerase, Isomerase; HET: SO4; 1.94A {Thermus thermophilus} SCOP: d.80.1.0",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 64,
      "target_eno": 13.0,
      "alignment": {
        "score": 35.61,
        "bit_score": 47.1,
        "evalue": 9.7e-05,
        "pvalue": 9.7e-05,
        "n_identities": 9,
        "n_positives": 42,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeeee     hhhhhhhhhhhhhhhhh      eeeeeeee   eeeeee e",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MVVLKVTLLEGRPPEKKRELVRRLTEMASRLLGEPYEEVRVILYEVRRDQWAAGGV",
        "middle": "+++++V++++ R++E+++++++++T++++R+   +YE+V+++++++++++++ +G+",
        "computed_K_ungapped": "0.1828",
        "computed_lambda_ungapped": "1.6693",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.8391",
        "entropy": 0.5348,
        "expected_score": -0.2860,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|P67526|Y1363_STAAM Probable tautomerase SAV1363 OS=Staphylococcus aureus (strain Mu50 \/ ATCC 700699) OX=158878 GN=SAV1363 PE=3 SV=2",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 61,
      "target_eno": 12.0,
      "alignment": {
        "score": 34.90,
        "bit_score": 46.4,
        "evalue": 0.00016,
        "pvalue": 0.00016,
        "n_identities": 8,
        "n_positives": 41,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "   eee       hhhhhhhhhhhhhhhhhh       eeeeeee     eee   ",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPIVNVKLLEGRSDEQLKNLVSEVTDAVEKTTGANRQAIHVVIEEMKPNHYGVAGV",
        "middle": "+P+V+V +++ R++E+++++++++T++++++   + ++++++++++++++Y+ +G+",
        "computed_K_ungapped": "0.1785",
        "computed_lambda_ungapped": "1.5920",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.8003",
        "entropy": 0.5219,
        "expected_score": -0.2806,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q9K6B5|Y3814_ALKHC Probable tautomerase BH3814 OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 \/ DSM 18197 \/ FERM 7344 \/ JCM 9153 \/ C-125) OX=272558 GN=BH3814 PE=3 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 61,
      "target_eno": 13.0,
      "alignment": {
        "score": 34.60,
        "bit_score": 46.3,
        "evalue": 0.00018,
        "pvalue": 0.00018,
        "n_identities": 10,
        "n_positives": 40,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "   eeeee     hhhhhhhhhhhhhhhhhhh     eeeeeeee     eee   ",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPIVTVKFLEGRSDEQKRALVERVTEAVAETIQANPEKIHVVLEEMRKDHYGVAGK",
        "middle": "+P+V+V++++ R++E+++++++++T++++++   + E++++++++++K++Y+ +G+",
        "computed_K_ungapped": "0.1773",
        "computed_lambda_ungapped": "1.6515",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.8302",
        "entropy": 0.5545,
        "expected_score": -0.2864,
        "min_score": -2,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "1GYX_B HYPOTHETICAL PROTEIN YDCE; TAUTOMERASE, ISOMERASE, HYPOTHETICAL PROTEIN, COMPLETE PROTEO; HET: EPE; 1.35A {ESCHERICHIA COLI} SCOP: d.80.1.1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 76,
      "target_eno": 11.0,
      "alignment": {
        "score": 36.42,
        "bit_score": 45.9,
        "evalue": 0.00023,
        "pvalue": 0.00023,
        "n_identities": 10,
        "n_positives": 37,
        "n_gaps": 5,
        "aln_length": 53,
        "query_from": 55,
        "query_to": 102,
        "target_from": 1,
        "target_to": 53,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": " eeeeeee     hhhhhhhhhhhhhhhhh        eeeeeee        ",
        "target_secstr": "  eeee       hhhhhhhhhhhhhhhhhh      eeeeeeee     eee",
        "query_aln": "PFVEVLWFA-R-DQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYE",
        "target_aln": "PHIDIKCFPRELDEQQKAALAADITDVIIRHLNSKDSSISIALQQIQPESWQA",
        "middle": "P++++ +F+ + D+++++++A++IT++I+R+   +++S++I++++++++++++",
        "computed_K_ungapped": "0.1815",
        "computed_lambda_ungapped": "1.3792",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.6933",
        "entropy": 0.3922,
        "expected_score": -0.2845,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|O25581|Y924_HELPY Probable tautomerase HP_0924 OS=Helicobacter pylori (strain ATCC 700392 \/ 26695) OX=85962 GN=HP_0924 PE=1 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 68,
      "target_eno": 12.0,
      "alignment": {
        "score": 35.35,
        "bit_score": 45.6,
        "evalue": 0.00028,
        "pvalue": 0.00028,
        "n_identities": 6,
        "n_positives": 45,
        "n_gaps": 7,
        "aln_length": 59,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 59,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee       hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "   eeeee        hhhhhhhhhhhhhhhhhhhh    eeeeeeee     eee   ",
        "query_aln": "YPFVEVLWFA----RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPFINIKLVPENGGPTNEQKQQLIEGVSDLMVKVLNKNKASIVVIIDEVDSNNYGLGGE",
        "middle": "+PF+++++++    +++E++++++++++++++++   + +S++++++++++++Y+++G+",
        "computed_K_ungapped": "0.1774",
        "computed_lambda_ungapped": "1.5134",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7608",
        "entropy": 0.4926,
        "expected_score": -0.2884,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q9CHZ4|Y574_LACLA Probable tautomerase LL0574 OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=LL0574 PE=3 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 61,
      "target_eno": 13.0,
      "alignment": {
        "score": 34.27,
        "bit_score": 45.4,
        "evalue": 0.00033,
        "pvalue": 0.00033,
        "n_identities": 14,
        "n_positives": 37,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "   eeeeee    hhhhhhhhhhhhhhhhhh       eeeeeee    eee    ",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPYVHVELFEGRTVEQKAIIAKEITESISKHAGAPTSAIHVIFNDLPEGMLYQGGE",
        "middle": "+P+V+V++F+ R++E+++++A++IT++I+++   ++++++++F++L+++++Y +G+",
        "computed_K_ungapped": "0.1636",
        "computed_lambda_ungapped": "1.6330",
        "estimated_K_gapped": "0.0021",
        "estimated_lambda_gapped": "0.8209",
        "entropy": 0.5317,
        "expected_score": -0.2820,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q71WL5|Y2536_LISMF Probable tautomerase LMOf2365_2536 OS=Listeria monocytogenes serotype 4b (strain F2365) OX=265669 GN=LMOf2365_2536 PE=3 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 61,
      "target_eno": 13.0,
      "alignment": {
        "score": 33.72,
        "bit_score": 44.6,
        "evalue": 0.00055,
        "pvalue": 0.00055,
        "n_identities": 9,
        "n_positives": 42,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "   eeeee     hhhhhhhhhhhhhhhhhh       eeeeeee     eee   ",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPFVTIQFLEGRTDDQKKALVSEVTEVVAKNLKAPKENIHVILEEMKKTDYGVGGV",
        "middle": "+PFV++++++ R++++++++++++T++++++   ++E++++++++++K++Y+ +G+",
        "computed_K_ungapped": "0.1576",
        "computed_lambda_ungapped": "1.5536",
        "estimated_K_gapped": "0.0020",
        "estimated_lambda_gapped": "0.7810",
        "entropy": 0.5300,
        "expected_score": -0.2840,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q93JW0|4OT4_PSEPU 2-hydroxymuconate tautomerase OS=Pseudomonas putida OX=303 GN=tdnL PE=3 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 63,
      "target_eno": 13.0,
      "alignment": {
        "score": 33.93,
        "bit_score": 44.4,
        "evalue": 0.00066,
        "pvalue": 0.00066,
        "n_identities": 8,
        "n_positives": 41,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "   eeeeee    hhhhhhhhhhhhhhhhhh      eeeeeeee     eeee  ",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPFAQIYMIEGRTEAQKKAVIEKVSQALVEATGAPMANVRVWIQEVPKENWGIAGV",
        "middle": "+PF+++++ + R+++++++V++++++++++A   + ++V++++++++K++++ +G+",
        "computed_K_ungapped": "0.1671",
        "computed_lambda_ungapped": "1.6415",
        "estimated_K_gapped": "0.0021",
        "estimated_lambda_gapped": "0.8251",
        "entropy": 0.5383,
        "expected_score": -0.2775,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q8Y183|Y807_RALSO Probable tautomerase RSc0807 OS=Ralstonia solanacearum (strain GMI1000) OX=267608 GN=RSc0807 PE=3 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 62,
      "target_eno": 13.0,
      "alignment": {
        "score": 33.46,
        "bit_score": 44.2,
        "evalue": 0.00077,
        "pvalue": 0.00077,
        "n_identities": 7,
        "n_positives": 42,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "   eeeeee    hhhhhhhhhhhhhhhhhhh      eeeeeee      hh   ",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPTFHIEMFEGRSADQKRKLVEEVTRVTCETLGCAPGAVDIIIAEVKRENWATGGV",
        "middle": "+P++++ +F+ R++++++++++++T++++++   + ++V+I+++++++++++ +G+",
        "computed_K_ungapped": "0.1755",
        "computed_lambda_ungapped": "1.6581",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.8335",
        "entropy": 0.5425,
        "expected_score": -0.2769,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q814P5|Y5378_BACCR Probable tautomerase BC_5378 OS=Bacillus cereus (strain ATCC 14579 \/ DSM 31 \/ JCM 2152 \/ NBRC 15305 \/ NCIMB 9373 \/ NRRL B-3711) OX=226900 GN=BC_5378 PE=3 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 61,
      "target_eno": 13.0,
      "alignment": {
        "score": 33.54,
        "bit_score": 43.9,
        "evalue": 0.00089,
        "pvalue": 0.00089,
        "n_identities": 11,
        "n_positives": 38,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "   eeeee     hhhhhhhhhhhhhhhhh        eeeeeeee   eeee   ",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPYVTVKMLEGRTEEQKKALAEKVTAAVSETTGAPEENIVVFIEEMSKNHYAVGGK",
        "middle": "+P+V+V +++ R++E+++++A+++T++++++   + E++++++++++K++Y+ +G+",
        "computed_K_ungapped": "0.1726",
        "computed_lambda_ungapped": "1.5724",
        "estimated_K_gapped": "0.0022",
        "estimated_lambda_gapped": "0.7904",
        "entropy": 0.5433,
        "expected_score": -0.2960,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q9PCQ3|Y1725_XYLFA Probable tautomerase XF_1725 OS=Xylella fastidiosa (strain 9a5c) OX=160492 GN=XF_1725 PE=3 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 82,
      "target_eno": 12.0,
      "alignment": {
        "score": 35.57,
        "bit_score": 43.6,
        "evalue": 0.0011,
        "pvalue": 0.0011,
        "n_identities": 7,
        "n_positives": 42,
        "n_gaps": 4,
        "aln_length": 55,
        "query_from": 54,
        "query_to": 104,
        "target_from": 1,
        "target_to": 55,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee          ",
        "target_secstr": "   eeeee     hhhhhhhhhhhhhhhhhhh      eeeeeee    eeeeee",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENG",
        "target_aln": "MPHIIVKIAEGRSQPLKQELADRLAATMMDVLGLDSSAVSVAVEDVPMQDWMQQV",
        "middle": "+P+++V++++ R+Q++++++A+++++ ++++   D+++V+++++++++++++ ++",
        "computed_K_ungapped": "0.1734",
        "computed_lambda_ungapped": "1.4219",
        "estimated_K_gapped": "0.0022",
        "estimated_lambda_gapped": "0.7148",
        "entropy": 0.4025,
        "expected_score": -0.2684,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|Q9RHM8|4OT_COMTE 2-hydroxymuconate tautomerase OS=Comamonas testosteroni OX=285 GN=aphI PE=3 SV=3",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 63,
      "target_eno": 13.0,
      "alignment": {
        "score": 33.23,
        "bit_score": 43.3,
        "evalue": 0.0014,
        "pvalue": 0.0014,
        "n_identities": 10,
        "n_positives": 40,
        "n_gaps": 4,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 105,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhh        eeeeeee           ",
        "target_secstr": "  eeeeeee    hhhhhhhhhhhhhhhhhh       eeeeee     eeeee e",
        "query_aln": "YPFVEVLWFA-RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENGQ",
        "target_aln": "MPFAQIYMLEGRSEEQKKAVIEKVTRALVEAVGAPSANVRVWIHDVPKENWGIAGV",
        "middle": "+PF+++++ + R++E++++V++++T+++++A   ++++V++++++++K++++ +G+",
        "computed_K_ungapped": "0.1679",
        "computed_lambda_ungapped": "1.6304",
        "estimated_K_gapped": "0.0022",
        "estimated_lambda_gapped": "0.8196",
        "entropy": 0.5421,
        "expected_score": -0.2867,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|A7MK78|PPTA_CROS8 Tautomerase PptA OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=pptA PE=3 SV=2",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 76,
      "target_eno": 12.0,
      "alignment": {
        "score": 33.64,
        "bit_score": 41.9,
        "evalue": 0.0037,
        "pvalue": 0.0037,
        "n_identities": 10,
        "n_positives": 38,
        "n_gaps": 5,
        "aln_length": 56,
        "query_from": 54,
        "query_to": 104,
        "target_from": 1,
        "target_to": 56,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee     hhhhhhhhhhhhhhhhh        eeeeeee          ",
        "target_secstr": "   eeee       hhhhhhhhhhhhhhhhhhh      eeeeeee     ee   ",
        "query_aln": "YPFVEVLWFAR--DQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYENG",
        "target_aln": "MPHIDVKFFPRDLSDAQQQALADELTQVIVKHLQSKESSVSVALKEVQPEQWKSEV",
        "middle": "+P+++V +F+R  ++++Q+++A+++T+ I+++   + +SV++++++++++++++++",
        "computed_K_ungapped": "0.1806",
        "computed_lambda_ungapped": "1.5152",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7617",
        "entropy": 0.4906,
        "expected_score": -0.2913,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|A6T9Q5|PPTA_KLEP7 Tautomerase PptA OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 \/ MGH 78578) OX=272620 GN=pptA PE=3 SV=1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 75,
      "target_eno": 12.0,
      "alignment": {
        "score": 31.51,
        "bit_score": 39.5,
        "evalue": 0.02,
        "pvalue": 0.02,
        "n_identities": 12,
        "n_positives": 37,
        "n_gaps": 5,
        "aln_length": 54,
        "query_from": 54,
        "query_to": 102,
        "target_from": 1,
        "target_to": 54,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee     hhhhhhhhhhhhhhhhh        eeeeeee        ",
        "target_secstr": "   ee         hhhhhhhhhhhhhhhhhh       eeeeeee       h",
        "query_aln": "YPFVEVLWFAR--DQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYE",
        "target_aln": "MPHVDIKCFPRELTDEQKTALAADITEVLIRHLNSKESAVSVALTQVEPDAWQA",
        "middle": "+P+V++++F+R  ++E+++++A++IT++++R+   ++++V++++T+++++A+++",
        "computed_K_ungapped": "0.1637",
        "computed_lambda_ungapped": "1.5108",
        "estimated_K_gapped": "0.0021",
        "estimated_lambda_gapped": "0.7595",
        "entropy": 0.4676,
        "expected_score": -0.2746,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|A4WAM9|PPTA_ENT38 Tautomerase PptA OS=Enterobacter sp. (strain 638) OX=399742 GN=pptA PE=3 SV=1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 76,
      "target_eno": 12.0,
      "alignment": {
        "score": 31.86,
        "bit_score": 39.4,
        "evalue": 0.02,
        "pvalue": 0.02,
        "n_identities": 10,
        "n_positives": 37,
        "n_gaps": 5,
        "aln_length": 55,
        "query_from": 54,
        "query_to": 103,
        "target_from": 1,
        "target_to": 55,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee     hhhhhhhhhhhhhhhhh        eeeeeee         ",
        "target_secstr": "   ee         hhhhhhhhhhhhhhhhhhh      eeeeeee  hhhhhhh",
        "query_aln": "YPFVEVLWFA--RDQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYEN",
        "target_aln": "MPHVDIKCFPRDLNDEQKTALAADIAEVIIRHFNSKDSSVSVALNQVQQEDWKAQ",
        "middle": "+P+V++++F+  +++E+++++A++I+++I+R    + +SV++++++++++++ ++",
        "computed_K_ungapped": "0.1826",
        "computed_lambda_ungapped": "1.4773",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7426",
        "entropy": 0.4423,
        "expected_score": -0.2776,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|B1XDG9|PPTA_ECODH Tautomerase PptA OS=Escherichia coli (strain K12 \/ DH10B) OX=316385 GN=pptA PE=3 SV=1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 77,
      "target_eno": 11.0,
      "alignment": {
        "score": 31.84,
        "bit_score": 39.2,
        "evalue": 0.023,
        "pvalue": 0.023,
        "n_identities": 11,
        "n_positives": 36,
        "n_gaps": 5,
        "aln_length": 54,
        "query_from": 54,
        "query_to": 102,
        "target_from": 1,
        "target_to": 54,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee     hhhhhhhhhhhhhhhhh        eeeeeee        ",
        "target_secstr": "   eeeee     hhhhhhhhhhhhhhhhhhh        eeeeee    hhhh",
        "query_aln": "YPFVEVLWFAR--DQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYE",
        "target_aln": "MPHIDIKCFPRELDEQQKAALAADITDVIIRHLNSKDSSISIALQQIQPESWQA",
        "middle": "+P++++++F+R  D+++++++A++IT++I+R+   + +S++I++++++++++ +",
        "computed_K_ungapped": "0.1816",
        "computed_lambda_ungapped": "1.4197",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7137",
        "entropy": 0.4329,
        "expected_score": -0.2821,
        "min_score": -3,
        "max_score": 3
      }
    }},
    {"hit_record": {
      "target_description": "sp|C6DH49|PPTA_PECCP Tautomerase PptA OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=pptA PE=3 SV=1",
      "query_length": 105,
      "query_eno": 7.0,
      "target_length": 76,
      "target_eno": 12.0,
      "alignment": {
        "score": 31.17,
        "bit_score": 38.9,
        "evalue": 0.03,
        "pvalue": 0.03,
        "n_identities": 8,
        "n_positives": 39,
        "n_gaps": 5,
        "aln_length": 54,
        "query_from": 54,
        "query_to": 102,
        "target_from": 1,
        "target_to": 54,
        "query_secstr_available": 1,
        "target_secstr_available": 1,
        "query_secstr": "  eeeeeee     hhhhhhhhhhhhhhhhh        eeeeeee        ",
        "target_secstr": "   eee        hhhhhhhhhhhhhhhhhhh      eeeeeee    hhhh",
        "query_aln": "YPFVEVLWFAR--DQEVQDLVAQTITNQIRRA---DYESVAIMFTTLTKSAYYE",
        "target_aln": "MPHIDVKHFPRNLSEEEKKVIAEDLAAVLKKHFGSSDDSLSVAFNEIQPDRWKD",
        "middle": "+P+++V +F+R  ++E+++++A++++++++++   + +S++++F++++++++++",
        "computed_K_ungapped": "0.1811",
        "computed_lambda_ungapped": "1.4802",
        "estimated_K_gapped": "0.0023",
        "estimated_lambda_gapped": "0.7441",
        "entropy": 0.4418,
        "expected_score": -0.2799,
        "min_score": -3,
        "max_score": 3
      }
    }}
  ],
  "search_statistics": {
    "reference_K_ungapped": 0.1158,
    "reference_lambda_ungapped": 1.1163,
    "reference_K_gapped": 0.0015,
    "reference_lambda_gapped": 0.5611,
    "query_length": 105,
    "database_size": 143238575,
    "effective_query_length": 105,
    "effective_database_size": 143238575,
    "effective_search_space": 15040050176
  }
}}
